Protein profile

PA2820

hypothetical protein

Genome: NC_002516.2

Gene: PA2820 Structure source: AlphaFold UniProt Q9I023
Export view
Amino acids 257
Annotations 0
Features 5
PDB binders 0
Druggability 0.692

Overview

Basic information about this protein and its source genome.

Accession
PA2820
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA2820
Status
annotated
Amino acids
257
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.692
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MSPLLITALIIGGIALLIAIGYINHVVENSKLEKARLKAELNDRVRRCAQISESLPGQFVSPSLKLLMSQIELSLSEQQLALQKKADAGLKARIEELRALVAKGESIPVRNPPQAILTEDKAKEVRFLFEALHAQLTRFTQDGHLPRSEAQIWVKEIRHLLVRLHIEFFGNLGQQALQQNEPRQARLAFERGAQYLRKQPELARYQAELQQMETQLARANAMVLNNSQPASEEPSELNEGLKALDADDLWKKKNVYD

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

5 records
Show feature table
Start End DB Term Name
28 257 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
202 222 Coils Coil Coil
6 27 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
4 26 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 5 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2820
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.692
5 0.382
3 0.362