Protein profile

PA2832

thiopurine S-methyltransferase

Genome: NC_002516.2

Gene: PA2832 tpm Structure source: AlphaFold UniProt Q9I011
Amino acids 218
Annotations 6
Features 16
PDB binders 2
Druggability 0.735

Overview

Basic information about this protein and its source genome.

Accession
PA2832
Gene
PA2832 tpm
Status
annotated
Amino acids
218
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
30.909
Human E-value
4.0200000000000003e-29
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.735
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MQADFWHARWANNQIGFHLDEINPYLMRHLSRLRLQAGEQILVPLCGKTLDLAWLAAQGLEVLGVELSEKAVSDFFEEHDLHPEIDQLDGFRRYRVAGITLLQGDFFALQAEHLAQCRAFYDRAALIALPPEMRERYAGHLQAVLPTRSLGLLVTIDYPQAEMAGPPFAVPDEEVRGYYAGGWRIEELERGDVLGVNWKFLERGVSWLDEAVYLLERG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0008119 Catalysis of the reaction: S-adenosyl-L-methionine + a thiopurine = S-adenosyl-L-homocysteine + a thiopurine S-methylether.
  • GO:0032259 The process in which a methyl group is covalently attached to a molecule.
  • GO:0010038 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a metal ion stimulus.
  • GO:0008757 Catalysis of the transfer of a methyl group from S-adenosyl-L-methionine to a substrate.

Sequence Features

Domain/signature hits from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
16 218 Gene3D G3DSA:3.40.50.150 Vaccinia Virus protein VP39
16 218 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
4 216 NCBIfam TIGR03840 thiopurine S-methyltransferase
4 216 InterPro IPR022474 Thiopurine S-methyltransferase, Se/Te detoxification
1 218 PIRSF PIRSF023956 TPMT
1 218 InterPro IPR025835 Thiopurine S-methyltransferase
1 214 PANTHER PTHR10259 THIOPURINE S-METHYLTRANSFERASE
1 217 Pfam PF05724 Thiopurine S-methyltransferase (TPMT)
1 217 InterPro IPR008854 TPMT family
1 216 SUPERFAMILY SSF53335 S-adenosyl-L-methionine-dependent methyltransferases
1 216 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
1 217 Hamap MF_00812 Thiopurine S-methyltransferase [tpm].
1 217 InterPro IPR025835 Thiopurine S-methyltransferase
1 218 FunFam G3DSA:3.40.50.150:FF:000101 Thiopurine S-methyltransferase
3 213 ProSiteProfiles PS51585 Thiopurine or thiol or thiocyanate S-methyltransferase (TPMT) family profile.
3 213 InterPro IPR008854 TPMT family

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2832
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.735
3 0.296

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

54 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
B3P P51580 282.3 Da LogP -4.01 TPSA 145.4 1 viol. ✓ Clean C(CNC(CO)(CO)CO)CNC(CO)(CO)CO
PM6 O55060 152.2 Da LogP 0.64 TPSA 54.5 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)c(ncn2)S

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.