Protein profile

PA2859

transcription elongation factor GreB

Genome: NC_002516.2

Gene: PA2859 greB Structure source: AlphaFold UniProt Q9HZY5
Export view
Amino acids 168
Annotations 4
Features 26
PDB binders 0
Druggability 0.655

Overview

Basic information about this protein and its source genome.

Accession
PA2859
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA2859 greB
Status
annotated
Amino acids
168
Structure source
AlphaFold
GO
GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid). GO:0070063 Binding to an RNA polymerase molecule or complex. GO:0006354 The extension of an RNA molecule after transcription initiation and promoter clearance at a DNA-dependent RNA polymerase promoter by the addition of ribonucleotides catalyzed by an RNA polymerase. GO:0032784 Any process that modulates the frequency, rate or extent of transcription elongation, the extension of an RNA molecule after transcription initiation and promoter clearance by the addition of ribonucleotides catalyzed by a DNA-dependent RNA polymerase.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.655
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MSRYRPPRTAGTPLITPEGAARLRAELHELWHVRRPQVTQAVSEAAALGDRSENAEYIYGKKMLREIDSRVRFLRKRLENLKVVGERPADPNRVYFGAWVTLEDEDGEQARYRIVGPDELDLRNNQISIDSPLARALVGKELDAEVLVRTPAGEKLWFVVEIEYPPAP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0070063 Binding to an RNA polymerase molecule or complex.
  • GO:0006354 The extension of an RNA molecule after transcription initiation and promoter clearance at a DNA-dependent RNA polymerase promoter by the addition of ribonucleotides catalyzed by an RNA polymerase.
  • GO:0032784 Any process that modulates the frequency, rate or extent of transcription elongation, the extension of an RNA molecule after transcription initiation and promoter clearance by the addition of ribonucleotides catalyzed by a DNA-dependent RNA polymerase.

Sequence Features

Domain/signature hits from InterPro and related databases.

26 records
Show feature table
Start End DB Term Name
64 84 Coils Coil Coil
12 165 NCBIfam TIGR01461 transcription elongation factor GreB
12 165 InterPro IPR006358 Transcription elongation factor GreB
11 163 Hamap MF_00105 Transcription elongation factor GreA [greA].
11 163 InterPro IPR028624 Transcription elongation factor GreA/GreB
92 164 Pfam PF01272 Transcription elongation factor, GreA/GreB, C-term
92 164 InterPro IPR001437 Transcription elongation factor, GreA/GreB, C-terminal
10 85 FunFam G3DSA:1.10.287.180:FF:000001 Transcription elongation factor GreA
9 166 PIRSF PIRSF006092 GreA_GreB
9 166 InterPro IPR023459 Transcription elongation factor GreA/GreB family
13 85 SUPERFAMILY SSF46557 GreA transcript cleavage protein, N-terminal domain
13 85 InterPro IPR036805 Transcription elongation factor, GreA/GreB, N-terminal domain superfamily
26 57 ProSitePatterns PS00829 Prokaryotic transcription elongation factors signature 1.
26 57 InterPro IPR018151 Transcription elongation factor, GreA/GreB, conserved site
88 165 FunFam G3DSA:3.10.50.30:FF:000001 Transcription elongation factor GreA
3 165 PANTHER PTHR30437 TRANSCRIPTION ELONGATION FACTOR GREA
3 165 InterPro IPR023459 Transcription elongation factor GreA/GreB family
11 84 Gene3D G3DSA:1.10.287.180 -
11 84 InterPro IPR036805 Transcription elongation factor, GreA/GreB, N-terminal domain superfamily
14 83 Pfam PF03449 Transcription elongation factor, N-terminal
14 83 InterPro IPR022691 Transcription elongation factor, GreA/GreB, N-terminal
87 165 Gene3D G3DSA:3.10.50.30 -
87 165 InterPro IPR036953 Transcription elongation factor GreA/GreB, C-terminal domain superfamily
10 165 Hamap MF_00930 Transcription elongation factor GreB [greB].
10 165 InterPro IPR006358 Transcription elongation factor GreB
89 164 SUPERFAMILY SSF54534 FKBP-like

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA2859
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.655