Overview
Basic information about this protein and its source genome.
- Accession
- PA2859
- Gene
- PA2859 greB
- Status
- annotated
- Amino acids
- 168
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSRYRPPRTAGTPLITPEGAARLRAELHELWHVRRPQVTQAVSEAAALGDRSENAEYIYGKKMLREIDSRVRFLRKRLENLKVVGERPADPNRVYFGAWVTLEDEDGEQARYRIVGPDELDLRNNQISIDSPLARALVGKELDAEVLVRTPAGEKLWFVVEIEYPPAP
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
4- GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
- GO:0070063 Binding to an RNA polymerase molecule or complex.
- GO:0006354 The extension of an RNA molecule after transcription initiation and promoter clearance at a DNA-dependent RNA polymerase promoter by the addition of ribonucleotides catalyzed by an RNA polymerase.
- GO:0032784 Any process that modulates the frequency, rate or extent of transcription elongation, the extension of an RNA molecule after transcription initiation and promoter clearance by the addition of ribonucleotides catalyzed by a DNA-dependent RNA polymerase.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 64 | 84 | Coils | Coil | Coil |
| 12 | 165 | NCBIfam | TIGR01461 | transcription elongation factor GreB |
| 12 | 165 | InterPro | IPR006358 | Transcription elongation factor GreB |
| 11 | 163 | Hamap | MF_00105 | Transcription elongation factor GreA [greA]. |
| 11 | 163 | InterPro | IPR028624 | Transcription elongation factor GreA/GreB |
| 92 | 164 | Pfam | PF01272 | Transcription elongation factor, GreA/GreB, C-term |
| 92 | 164 | InterPro | IPR001437 | Transcription elongation factor, GreA/GreB, C-terminal |
| 10 | 85 | FunFam | G3DSA:1.10.287.180:FF:000001 | Transcription elongation factor GreA |
| 9 | 166 | PIRSF | PIRSF006092 | GreA_GreB |
| 9 | 166 | InterPro | IPR023459 | Transcription elongation factor GreA/GreB family |
| 13 | 85 | SUPERFAMILY | SSF46557 | GreA transcript cleavage protein, N-terminal domain |
| 13 | 85 | InterPro | IPR036805 | Transcription elongation factor, GreA/GreB, N-terminal domain superfamily |
| 26 | 57 | ProSitePatterns | PS00829 | Prokaryotic transcription elongation factors signature 1. |
| 26 | 57 | InterPro | IPR018151 | Transcription elongation factor, GreA/GreB, conserved site |
| 88 | 165 | FunFam | G3DSA:3.10.50.30:FF:000001 | Transcription elongation factor GreA |
| 3 | 165 | PANTHER | PTHR30437 | TRANSCRIPTION ELONGATION FACTOR GREA |
| 3 | 165 | InterPro | IPR023459 | Transcription elongation factor GreA/GreB family |
| 11 | 84 | Gene3D | G3DSA:1.10.287.180 | - |
| 11 | 84 | InterPro | IPR036805 | Transcription elongation factor, GreA/GreB, N-terminal domain superfamily |
| 14 | 83 | Pfam | PF03449 | Transcription elongation factor, N-terminal |
| 14 | 83 | InterPro | IPR022691 | Transcription elongation factor, GreA/GreB, N-terminal |
| 87 | 165 | Gene3D | G3DSA:3.10.50.30 | - |
| 87 | 165 | InterPro | IPR036953 | Transcription elongation factor GreA/GreB, C-terminal domain superfamily |
| 10 | 165 | Hamap | MF_00930 | Transcription elongation factor GreB [greB]. |
| 10 | 165 | InterPro | IPR006358 | Transcription elongation factor GreB |
| 89 | 164 | SUPERFAMILY | SSF54534 | FKBP-like |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA2859
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.655 |