Protein profile

PA3029

molybdopterin biosynthesis protein B

Genome: NC_002516.2

Gene: PA3029 moaB2 Structure source: AlphaFold UniProt Q9HZH7
Amino acids 179
Annotations 3
Features 21
PDB binders 10
Druggability 0.692

Overview

Basic information about this protein and its source genome.

Accession
PA3029
Gene
PA3029 moaB2
Status
annotated
Amino acids
179
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
32.222
Human E-value
1.67e-08
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.692
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MSHKAETAFVPLNIAVLTVSDTRTLETDTSGQLFVDRLTEAGHNLAARVLLKDDLYRIRAQVATWIAEDSVQVVLITGGTGFTGRDSTPEAVACLLDKQVDGFGELFRQISLADIGTSTIQSRALAGLSNGTLVCCLPGSTNACRTAWEGILVEQLDARHRPCNFVPHLKQAAPCESRG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0005525 Binding to GTP, guanosine triphosphate.
  • GO:0006777 The chemical reactions and pathways resulting in the formation of the Mo-molybdopterin cofactor, essential for the catalytic activity of some enzymes. The cofactor consists of a mononuclear molybdenum (Mo) ion coordinated by one or two molybdopterin ligands.

Sequence Features

Domain/signature hits from InterPro and related databases.

21 records
Show feature table
Start End DB Term Name
1 167 PIRSF PIRSF006443 MoaB
1 167 InterPro IPR012245 Molybdenum cofactor biosynthesis protein MoaB
13 152 NCBIfam TIGR00177 molybdenum cofactor biosynthesis domain
13 152 InterPro IPR001453 MoaB/Mog domain
3 173 Gene3D G3DSA:3.40.980.10 -
3 173 InterPro IPR036425 MoaB/Mog-like domain superfamily
9 170 NCBIfam TIGR02667 molybdenum cofactor biosynthesis protein B
9 170 InterPro IPR013484 Molybdenum cofactor biosynthesis protein B, proteobacteria
15 157 Pfam PF00994 Probable molybdopterin binding domain
15 157 InterPro IPR001453 MoaB/Mog domain
3 170 PANTHER PTHR43232 MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN B
3 170 InterPro IPR012245 Molybdenum cofactor biosynthesis protein MoaB
12 152 CDD cd00886 MogA_MoaB
12 152 InterPro IPR001453 MoaB/Mog domain
73 86 ProSitePatterns PS01078 Molybdenum cofactor biosynthesis proteins signature 1.
73 86 InterPro IPR008284 Molybdenum cofactor biosynthesis, conserved site
8 169 SUPERFAMILY SSF53218 Molybdenum cofactor biosynthesis proteins
8 169 InterPro IPR036425 MoaB/Mog-like domain superfamily
1 171 FunFam G3DSA:3.40.980.10:FF:000003 Molybdenum cofactor biosynthesis protein B
15 159 SMART SM00852 MoCF_biosynth_3a
15 159 InterPro IPR001453 MoaB/Mog domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3029
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
3 0.692
1 0.212

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

60 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
3F7 Q03555 268.2 Da LogP 0.55 TPSA 74.8 ✓ Ro5 ✓ Clean c1cc(ccc1N2C(=O)C=CC2=O)N3C(=O)C=CC3=O
3F8 Q03555 308.3 Da LogP -1.13 TPSA 93.2 ✓ Ro5 ✓ Clean C1=CC(=O)N(C1=O)CCOCCOCCN2C(=O)C=CC2=O
B3P B2HEA7 282.3 Da LogP -4.01 TPSA 145.4 1 viol. ✓ Clean C(CNC(CO)(CO)CO)CNC(CO)(CO)CO
D8Z Q03555 298.4 Da LogP 2.84 TPSA 46.2 ✓ Ro5 ✓ Clean C[C@@H]1CC[C@H]2[C@H]([C@H](O[C@H]3[C@@]24[C@H]…
D95 Q03555 384.4 Da LogP 2.60 TPSA 100.5 ✓ Ro5 ✓ Clean C[C@@H]1CC[C@H]2[C@H]([C@@H](O[C@H]3[C@@]24[C@H…
MO Q03555 95.9 Da LogP -0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [Mo]
MOO Q03555 159.9 Da LogP -2.62 TPSA 80.3 ✓ Ro5 ✓ Clean [O-][Mo](=O)(=O)[O-]
NWS Q39054 868.5 Da LogP -2.05 TPSA 384.2 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
W Q03555 183.8 Da LogP -0.00 TPSA 0.0 ✓ Ro5 ✓ Clean [W+6]
WO4 Q03555 247.8 Da LogP -2.62 TPSA 80.3 ✓ Ro5 ✓ Clean [O-][W](=O)(=O)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.