Overview
Basic information about this protein and its source genome.
- Accession
- PA3047
- Gene
- PA3047
- Status
- annotated
- Amino acids
- 476
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Periplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MFKSLRTLAFATLLPFALPTLAQVNATLPANVQKALQTNKLTGNDLSLVLIPLDGPGNPTYYNADVSVNPASTMKLFTTYAALEMLGPTYQWKTEFYTDGQLKNGVLNGNLYLKGGGDPKLNMEKLWLLMRDLRANGVTKVTGDLVLDRSYFNIPQLPVFNDDGGDDTKPFLVGPDSLLVNLKSVRMVVRTDGNKVNVQMDPPLANVRIDNQVKMTAPATCPAWPKLRFSPVTQFDGTTLLATGQIPQGCSAQTYMSLLDHPGYTAGAVRGIWQELGGSILGKDRQGSVPRNATLIAKAFSPDLVEIIRDINKYSNNTMARQLFLSIGAQFRNSADGDDAQAAQRVVRQWLARKGITAPRLVMENGSGLSRQERVSAREMAAMLQAAWHSPYAAEYISSLPLAGLDGTMRKRLRRTALVGEAHVKTGTLNTVRALAGFSRDASGHNWVVVAILNSPRPWGASAILDQVLLSLHARK
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
5- GO:0004175 Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
- GO:0004185 Catalysis of the hydrolysis of a single C-terminal amino acid residue from the C-terminus of a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
- GO:0009252 The chemical reactions and pathways resulting in the formation of peptidoglycans, any of a class of glycoconjugates found in bacterial cell walls and consisting of long glycan strands of alternating residues of beta-(1,4) linked N-acetylglucosamine and N-acetylmuramic acid, cross-linked by short peptides.
- GO:0000270 The chemical reactions and pathways involving peptidoglycans, any of a class of glycoconjugates found only in bacterial cell walls and consisting of long glycan strands of alternating residues of beta-(1,4) linked N-acetylglucosamine and N-acetylmuramic acid, cross-linked by short peptides.
- GO:0006508 The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 22 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 96 | 163 | FunFam | G3DSA:3.50.80.20:FF:000002 | D-alanyl-D-alanine carboxypeptidase dacB |
| 1 | 22 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 1 | 22 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 7 | 474 | PANTHER | PTHR30023 | D-ALANYL-D-ALANINE CARBOXYPEPTIDASE |
| 7 | 474 | InterPro | IPR000667 | Peptidase S13, D-Ala-D-Ala carboxypeptidase C |
| 19 | 22 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 62 | 454 | NCBIfam | TIGR00666 | D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase |
| 62 | 454 | InterPro | IPR000667 | Peptidase S13, D-Ala-D-Ala carboxypeptidase C |
| 1 | 6 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 23 | 476 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 7 | 18 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 92 | 163 | Gene3D | G3DSA:3.50.80.20 | - |
| 27 | 469 | SUPERFAMILY | SSF56601 | beta-lactamase/transpeptidase-like |
| 27 | 469 | InterPro | IPR012338 | Beta-lactamase/transpeptidase-like |
| 30 | 454 | Pfam | PF02113 | D-Ala-D-Ala carboxypeptidase 3 (S13) family |
| 30 | 454 | InterPro | IPR000667 | Peptidase S13, D-Ala-D-Ala carboxypeptidase C |
| 280 | 468 | Gene3D | G3DSA:3.40.710.10 | - |
| 280 | 468 | InterPro | IPR012338 | Beta-lactamase/transpeptidase-like |
| 355 | 369 | PRINTS | PR00922 | D-Ala-D-Ala carboxypeptidase 3 (S13) family signature |
| 355 | 369 | InterPro | IPR000667 | Peptidase S13, D-Ala-D-Ala carboxypeptidase C |
| 68 | 87 | PRINTS | PR00922 | D-Ala-D-Ala carboxypeptidase 3 (S13) family signature |
| 68 | 87 | InterPro | IPR000667 | Peptidase S13, D-Ala-D-Ala carboxypeptidase C |
| 370 | 384 | PRINTS | PR00922 | D-Ala-D-Ala carboxypeptidase 3 (S13) family signature |
| 370 | 384 | InterPro | IPR000667 | Peptidase S13, D-Ala-D-Ala carboxypeptidase C |
| 432 | 445 | PRINTS | PR00922 | D-Ala-D-Ala carboxypeptidase 3 (S13) family signature |
| 432 | 445 | InterPro | IPR000667 | Peptidase S13, D-Ala-D-Ala carboxypeptidase C |
| 295 | 317 | PRINTS | PR00922 | D-Ala-D-Ala carboxypeptidase 3 (S13) family signature |
| 295 | 317 | InterPro | IPR000667 | Peptidase S13, D-Ala-D-Ala carboxypeptidase C |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA3047
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.762 | ||||||
| 3 | 0.568 | ||||||
| 6 | 0.24 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 33D | P39045 | 102.2 Da LogP 1.41 TPSA 20.2 | ✓ Ro5 | ✓ Clean |
CC(C)(C)CCO
|
|
| AIX | P45161 | 351.4 Da LogP 0.26 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
CC1([C@@H](N[C@H](S1)[C@@H](C=O)NC(=O)[C@@H](c2…
|
|
| B07 | P39045 | 239.0 Da LogP -0.55 TPSA 88.0 | ✓ Ro5 | ✓ Clean |
B(CNC(=O)c1c(cccc1OC)OC)(O)O
|
|
| BH6 | P39045 | 213.4 Da LogP 0.08 TPSA 69.6 | ✓ Ro5 | ✓ Clean |
B(CNC(=O)c1ccccc1Cl)(O)O
|
|
| BIY | P39045 | 217.2 Da LogP 0.48 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
CC1([C@@H](NC=C(S1)C(=O)O)C(=O)O)C
|
|
| BO8 | P39045 | 263.1 Da LogP -2.08 TPSA 153.1 | 1 viol. | ✓ Clean |
[B-]([C@@H](C)NC(=O)CCCC[C@H](C(=O)O)N)(O)(O)O
|
|
| CMV | P45161 | 491.6 Da LogP -0.50 TPSA 148.1 | ✓ Ro5 | ✓ Clean |
CCN1CCN(C(=O)C1=O)N[C@H](c2ccccc2)C(=O)N[C@H](C…
|
|
| EWA | P39045 | 253.1 Da LogP -0.17 TPSA 88.0 | ✓ Ro5 | ✓ Clean |
B([C@@H](C)NC(=O)c1c(cccc1OC)OC)(O)O
|
|
| EWB | P39045 | 300.1 Da LogP 0.85 TPSA 89.8 | ✓ Ro5 | ✓ Clean |
[B-]([C@@H](C)NC(=O)c1ccccc1Cc2ccccc2)(O)(O)O
|
|
| FMZ | P45161 | 435.5 Da LogP -0.16 TPSA 139.9 | ✓ Ro5 | ✓ Clean |
CC1([C@@H](N[C@H](S1)[C@@H](C=O)NC(=O)[C@@H](c2…
|
|
| FP5 | P39045 | 193.0 Da LogP -0.64 TPSA 69.6 | ✓ Ro5 | ✓ Clean |
B(CNC(=O)Cc1ccccc1)(O)O
|
|
| HQZ | P39045 | 184.0 Da LogP -2.62 TPSA 106.9 | ✓ Ro5 | ✓ Clean |
[B-]([C@@H](C)NS(=O)(=O)C)(O)(O)O
|
|
| NCF | P39045 | 342.4 Da LogP 0.85 TPSA 116.1 | ✓ Ro5 | ✓ Clean |
c1cc(sc1)CC(=O)N[C@@H]([C@@H]2N=C(CCS2)C(=O)O)C…
|
|
| REC | P39045 | 387.4 Da LogP -0.32 TPSA 179.4 | ✓ Ro5 | ✓ Clean |
C=C1CS[C@@H](N=C1C(=O)O)[C@@H](C(=O)O)NC(=O)CCC…
|
|
| REZ | P39844 | 246.3 Da LogP -0.45 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@H](C(=O)O)NC(=O)CCCC[C@H](C(=O)O)N
|
|
| TFR | P39045 | 300.3 Da LogP 0.39 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
C[C@H]([C@@H](C(F)(F)F)O)NC(=O)CCCC[C@H](C(=O)O…
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
| Ligand | UniProt (homolog) | pchembl | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| CHEMBL1672910 | P39045 | 7.20 | 359.2 Da LogP 3.00 TPSA 69.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)c1ccccc1C(c1ccccc1)c1ccccc1)B(O)O
|
| CHEMBL1672909 | P39045 | 7.10 | 347.2 Da LogP 2.20 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)c1ccccc1C(=O)c1ccc2ccccc2c1)B(O)O
|
| CHEMBL1672822 | P39045 | 6.57 | 287.1 Da LogP 1.62 TPSA 69.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)c1c(F)cccc1-c1ccccc1)B(O)O
|
| CHEMBL2035292 | P39045 | 6.44 | 224.0 Da LogP -0.66 TPSA 112.7 | ✓ Ro5 | ✓ Clean |
O=C(NCB(O)O)c1ccccc1[N+](=O)[O-]
|
| CHEMBL1672908 | P39045 | 6.43 | 348.2 Da LogP 0.62 TPSA 115.7 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)c1ccccc1NS(=O)(=O)c1ccccc1)B(O)O
|
| CHEMBL1672823 | P39045 | 6.30 | 229.0 Da LogP 0.10 TPSA 69.6 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)c1c(F)cccc1F)B(O)O
|
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1529737 | 0.800 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC2384790 | 0.800 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O
|
| ZINC2560745 | 0.800 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC2560989 | 0.800 | 218.2 Da LogP -1.23 TPSA 129.7 | ✓ Ro5 | ✓ Clean |
C[C@H](NC(=O)CC[C@@H](N)C(=O)O)C(=O)O
|
| ZINC472553 | 0.775 | 318.4 Da LogP 2.63 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CC(C)NC(=O)c1ccccc1NS(=O)(=O)c1ccccc1
|
| ZINC255982699 | 0.725 | 367.4 Da LogP 0.15 TPSA 141.8 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]([C@H](NC(=O)[C@@H](N)c2ccccc2)C(=O…
|
| ZINC255982700 | 0.725 | 367.4 Da LogP 0.15 TPSA 141.8 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]([C@H](NC(=O)[C@@H](N)c2ccccc2)C(=O…
|
| ZINC34064296 | 0.725 | 367.4 Da LogP 0.15 TPSA 141.8 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]([C@H](NC(=O)[C@H](N)c2ccccc2)C(=O…
|
| ZINC34064298 | 0.725 | 367.4 Da LogP 0.15 TPSA 141.8 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]([C@H](NC(=O)[C@H](N)c2ccccc2)C(=O)…
|
| ZINC34064299 | 0.725 | 367.4 Da LogP 0.15 TPSA 141.8 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]([C@H](NC(=O)[C@H](N)c2ccccc2)C(=O)…
|
| ZINC34648375 | 0.725 | 367.4 Da LogP 0.15 TPSA 141.8 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@@H]([C@@H](NC(=O)[C@H](N)c2ccccc2)C(=…
|
| ZINC34648377 | 0.725 | 367.4 Da LogP 0.15 TPSA 141.8 | ✓ Ro5 | ✓ Clean |
CC1(C)S[C@H]([C@@H](NC(=O)[C@H](N)c2ccccc2)C(=O…
|
| ZINC1794689 | 0.714 | 358.3 Da LogP 1.66 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C(NCCNC(=O)c1ccccc1[N+](=O)[O-])c1ccccc1[N+](…
|
| ZINC6362154 | 0.705 | 380.5 Da LogP 3.98 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
C[C@H](NC(=O)c1ccccc1NS(=O)(=O)c1ccccc1)c1ccccc1
|
| ZINC6362156 | 0.705 | 380.5 Da LogP 3.98 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)c1ccccc1NS(=O)(=O)c1ccccc1)c1cccc…
|
| ZINC479486 | 0.689 | 332.4 Da LogP 3.02 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CC[C@@H](C)NC(=O)c1ccccc1NS(=O)(=O)c1ccccc1
|
| ZINC479487 | 0.689 | 332.4 Da LogP 3.02 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CC[C@H](C)NC(=O)c1ccccc1NS(=O)(=O)c1ccccc1
|
| ZINC6248672 | 0.688 | 388.4 Da LogP 1.88 TPSA 95.1 | ✓ Ro5 | ✓ Clean |
COc1cccc(OC)c1C(=O)NCCNC(=O)c1c(OC)cccc1OC
|
| ZINC13514803 | 0.686 | 347.3 Da LogP -1.88 TPSA 196.1 | 1 viol. | ✓ Clean |
C[C@H](NC(=O)CC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=…
|
| ZINC17323222 | 0.683 | 315.4 Da LogP 4.77 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
C[C@@H](NC(=O)c1ccccc1Cc1ccccc1)c1ccccc1
|
| ZINC17323224 | 0.683 | 315.4 Da LogP 4.77 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
C[C@H](NC(=O)c1ccccc1Cc1ccccc1)c1ccccc1
|
| ZINC2574816 | 0.676 | 386.4 Da LogP 2.44 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C(NCCCCNC(=O)c1ccccc1[N+](=O)[O-])c1ccccc1[N+…
|
| ZINC40159536 | 0.674 | 283.4 Da LogP 3.04 TPSA 38.3 | ✓ Ro5 | ✓ Clean |
COC[C@H](C)NC(=O)c1ccccc1Cc1ccccc1
|
| ZINC40159537 | 0.674 | 283.4 Da LogP 3.04 TPSA 38.3 | ✓ Ro5 | ✓ Clean |
COC[C@@H](C)NC(=O)c1ccccc1Cc1ccccc1
|
| ZINC1794691 | 0.667 | 337.2 Da LogP 3.15 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C(NCCNC(=O)c1ccccc1Cl)c1ccccc1Cl
|
| ZINC1700512 | 0.658 | 388.3 Da LogP 1.02 TPSA 164.7 | ✓ Ro5 | ✓ Clean |
O=C(NCC(O)CNC(=O)c1ccccc1[N+](=O)[O-])c1ccccc1[…
|
| ZINC3162861 | 0.658 | 224.2 Da LogP 0.41 TPSA 109.5 | ✓ Ro5 | ✓ Clean |
O=C(O)CNC(=O)c1ccccc1[N+](=O)[O-]
|
| ZINC4671145 | 0.658 | 414.4 Da LogP 3.22 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C(NCCCCCCNC(=O)c1ccccc1[N+](=O)[O-])c1ccccc1[…
|
| ZINC8443802 | 0.658 | 428.4 Da LogP 3.61 TPSA 144.5 | ✓ Ro5 | ✓ Clean |
O=C(NCCCCCCCNC(=O)c1ccccc1[N+](=O)[O-])c1ccccc1…
|
| ZINC6702503 | 0.657 | 279.4 Da LogP 3.11 TPSA 47.6 | ✓ Ro5 | ✓ Clean |
COc1cccc(OC)c1C(=O)NC(C(C)C)C(C)C
|
| ZINC5527489 | 0.647 | 416.5 Da LogP 2.66 TPSA 95.1 | ✓ Ro5 | ✓ Clean |
COc1cccc(OC)c1C(=O)NCCCCNC(=O)c1c(OC)cccc1OC
|
| ZINC1115628 | 0.644 | 352.8 Da LogP 3.28 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CC(C)NC(=O)c1ccccc1NS(=O)(=O)c1ccc(Cl)cc1
|
| ZINC469077 | 0.644 | 336.4 Da LogP 2.76 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CC(C)NC(=O)c1ccccc1NS(=O)(=O)c1ccc(F)cc1
|
| ZINC2744965 | 0.643 | 296.4 Da LogP 1.70 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C(Cc1ccccc1)NCCNC(=O)Cc1ccccc1
|
| ZINC103208 | 0.641 | 222.2 Da LogP 1.98 TPSA 72.2 | ✓ Ro5 | ✓ Clean |
CC(C)CNC(=O)c1ccccc1[N+](=O)[O-]
|
| ZINC1893892 | 0.641 | 301.3 Da LogP 2.43 TPSA 115.4 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccccc1[N+](=O)[O-])c1ccccc1[N+](=O)[O-]
|
| ZINC38750 | 0.641 | 256.3 Da LogP 2.52 TPSA 72.2 | ✓ Ro5 | ✓ Clean |
O=C(NCc1ccccc1)c1ccccc1[N+](=O)[O-]
|
| ZINC5430994 | 0.641 | 208.2 Da LogP 1.73 TPSA 72.2 | ✓ Ro5 | ✓ Clean |
CCCNC(=O)c1ccccc1[N+](=O)[O-]
|
| ZINC396951 | 0.632 | 225.3 Da LogP 2.64 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
CNC(=O)c1ccccc1Cc1ccccc1
|
| ZINC1115797 | 0.630 | 397.3 Da LogP 3.39 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CC(C)NC(=O)c1ccccc1NS(=O)(=O)c1ccc(Br)cc1
|
| ZINC479477 | 0.630 | 332.4 Da LogP 2.87 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CC(C)CNC(=O)c1ccccc1NS(=O)(=O)c1ccccc1
|
| ZINC2874859 | 0.629 | 220.2 Da LogP 0.96 TPSA 71.3 | ✓ Ro5 | ✓ Clean |
COc1cccc(OC)c1C(=O)NCC#N
|
| ZINC655968 | 0.629 | 464.5 Da LogP 3.58 TPSA 95.1 | ✓ Ro5 | ✓ Clean |
COc1cccc(OC)c1C(=O)NCc1ccc(CNC(=O)c2c(OC)cccc2O…
|
| ZINC22761393 | 0.625 | 204.2 Da LogP 0.96 TPSA 72.2 | ✓ Ro5 | ✓ Clean |
C#CCNC(=O)c1ccccc1[N+](=O)[O-]
|
| ZINC2766183 | 0.625 | 365.3 Da LogP 3.93 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=C(NCCCCNC(=O)c1ccccc1Cl)c1ccccc1Cl
|
| ZINC2874906 | 0.625 | 205.2 Da LogP 0.85 TPSA 96.0 | ✓ Ro5 | ✓ Clean |
N#CCNC(=O)c1ccccc1[N+](=O)[O-]
|
| ZINC4681612 | 0.625 | 331.3 Da LogP 1.89 TPSA 101.3 | ✓ Ro5 | ✓ Clean |
O=C(NCCNC(=O)c1ccccc1[N+](=O)[O-])c1ccccc1F
|
| ZINC7986375 | 0.625 | 248.2 Da LogP 1.89 TPSA 72.2 | ✓ Ro5 | ✓ Clean |
O=C(NCC(F)(F)F)c1ccccc1[N+](=O)[O-]
|
| ZINC361383 | 0.621 | 225.3 Da LogP 2.55 TPSA 29.1 | ✓ Ro5 | ✓ Clean |
O=C(Cc1ccccc1)NCc1ccccc1
|
| ZINC36712787 | 0.619 | 324.4 Da LogP 2.78 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
CC(C)C(=O)NCCNC(=O)c1ccccc1Cc1ccccc1
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.