Protein profile

PA3062

pellicle/biofilm biosynthesis outer membrane protein PelC

Genome: NC_002516.2

Gene: pelC PA3062 Structure source: AlphaFold UniProt Q9HZE6
Export view
Amino acids 172
Annotations 2
Features 11
PDB binders 0
Druggability 0.723

Overview

Basic information about this protein and its source genome.

Accession
PA3062
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
pelC PA3062
Status
annotated
Amino acids
172
Structure source
AlphaFold
GO
GO:0015774 The directed movement of polysaccharides into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. A polysaccharide is a polymer of many (typically more than 10) monosaccharide residues linked glycosidically. GO:0044010 A process in which planktonically growing microorganisms of the same species grow at a liquid-air interface or on a solid substrate under the flow of a liquid and produce extracellular polymers that facilitate matrix formation, resulting in a change in the organisms' growth rate and gene transcription.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
OuterMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.723
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MQSIRCLALAAVALFMAGCSSFTSESATPLARGAQWGLVPLLNYSQAPQAGERAEQILLSVLAEEGVRPRLYPAQPQGDLQLVDDRERQQRALDWARQQKLAYVVTGSVEEWQYKNGLDGEPAVGVSLQVLEPASGRVLWSTSGARAGWSRESLAGAAQKVLRELVGDLRLE

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0015774 The directed movement of polysaccharides into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. A polysaccharide is a polymer of many (typically more than 10) monosaccharide residues linked glycosidically.
  • GO:0044010 A process in which planktonically growing microorganisms of the same species grow at a liquid-air interface or on a solid substrate under the flow of a liquid and produce extracellular polymers that facilitate matrix formation, resulting in a change in the organisms' growth rate and gene transcription.

Sequence Features

Domain/signature hits from InterPro and related databases.

11 records
Show feature table
Start End DB Term Name
6 15 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 19 ProSiteProfiles PS51257 Prokaryotic membrane lipoprotein lipid attachment site profile.
34 172 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 33 Phobius SIGNAL_PEPTIDE Signal peptide region
1 5 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
38 171 Gene3D G3DSA:3.40.50.10610 -
1 26 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
16 33 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
38 171 FunFam G3DSA:3.40.50.10610:FF:000006 Penicillin-binding protein activator LpoB
1 21 SignalP_EUK SignalP-noTM SignalP-noTM
1 26 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3062
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.723
2 0.5