Protein profile
PA3062
pellicle/biofilm biosynthesis outer membrane protein PelC
Genome: NC_002516.2
Overview
Basic information about this protein and its source genome.
- Accession
- PA3062
- Gene
- pelC PA3062
- Status
- annotated
- Amino acids
- 172
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- OuterMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MQSIRCLALAAVALFMAGCSSFTSESATPLARGAQWGLVPLLNYSQAPQAGERAEQILLSVLAEEGVRPRLYPAQPQGDLQLVDDRERQQRALDWARQQKLAYVVTGSVEEWQYKNGLDGEPAVGVSLQVLEPASGRVLWSTSGARAGWSRESLAGAAQKVLRELVGDLRLE
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0015774 The directed movement of polysaccharides into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. A polysaccharide is a polymer of many (typically more than 10) monosaccharide residues linked glycosidically.
- GO:0044010 A process in which planktonically growing microorganisms of the same species grow at a liquid-air interface or on a solid substrate under the flow of a liquid and produce extracellular polymers that facilitate matrix formation, resulting in a change in the organisms' growth rate and gene transcription.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 6 | 15 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 1 | 19 | ProSiteProfiles | PS51257 | Prokaryotic membrane lipoprotein lipid attachment site profile. |
| 34 | 172 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 33 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 1 | 5 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 38 | 171 | Gene3D | G3DSA:3.40.50.10610 | - |
| 1 | 26 | SignalP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM |
| 16 | 33 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 38 | 171 | FunFam | G3DSA:3.40.50.10610:FF:000006 | Penicillin-binding protein activator LpoB |
| 1 | 21 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 1 | 26 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA3062
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.723 | ||||||
| 2 | 0.5 |