Protein profile

PA3076

hypothetical protein

Genome: NC_002516.2

Gene: PA3076 Structure source: AlphaFold UniProt Q9HZD2

Export view

Amino acids 359

Annotations 2

Features 15

PDB binders 0

Druggability 0.745

Overview

Basic information about this protein and its source genome.

Accession: PA3076
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA3076
Status: annotated
Amino acids: 359
Structure source: AlphaFold

GO:0052689 Catalysis of the hydrolysis of a carboxylic ester bond. GO:0050525 Catalysis of the reaction: cutin + H2O = cutin monomers.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.745

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MRFRTLYLVLCGLLLGHAATAAEPPTAPTPPTQPAEGPGGADYRHASVHQWHFGEGAREYWVFTPEQPVPGNAPLVIFLHGWSVMQPDLYRAWIDHIVRRGMVVVYPRYQPDLKTPNAAFLDNAAGALGDALRRLQAGELGVRPRLNQVAYLGHSAGGLLAANLAAASERLKLPAAKALMVVEPGKSQGKRWDGVAQERLSGLAKGTLLLAVCGDEDSHVACTDAKRIYRQSRHIPPSDKNLLLLRSDRHGAPPLLANHAAPTAPVFGPQYPKEEDSDWLLDRVEKRLEVQQAEGRYTGHDPLVIDALDWYGTWKLFDGLTDAAFYNRNRQYALGATPEQTGMGQWSDGTPVKPIKVLK

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

GO:0052689 Catalysis of the hydrolysis of a carboxylic ester bond.
GO:0050525 Catalysis of the reaction: cutin + H2O = cutin monomers.

Sequence Features

Domain/signature hits from InterPro and related databases.

15 records

Show feature table

Start	End	DB	Term	Name
1	21	SignalP_GRAM_POSITIVE	SignalP-TM	SignalP-TM
61	188	Pfam	PF12740	Chlorophyllase enzyme
61	188	InterPro	IPR041127	Cutinase
5	16	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
28	286	Gene3D	G3DSA:3.40.50.1820	alpha/beta hydrolase
28	286	InterPro	IPR029058	Alpha/Beta hydrolase fold
17	21	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
22	359	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
25	190	PANTHER	PTHR33428	CHLOROPHYLLASE-2, CHLOROPLASTIC
1	21	SignalP_EUK	SignalP-noTM	SignalP-noTM
22	41	MobiDBLite	mobidb-lite	consensus disorder prediction
26	253	SUPERFAMILY	SSF53474	alpha/beta-Hydrolases
26	253	InterPro	IPR029058	Alpha/Beta hydrolase fold
1	21	Phobius	SIGNAL_PEPTIDE	Signal peptide region
1	4	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA3076	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.745