Protein target profile

PA3094

transcriptional regulator

Genome: NC_002516.2

Gene: PA3094 3D evidence: AlphaFold DB model UniProt Q9HZB4
Export view
Length 345
Pocket druggability 0.684
EC / GO 0 / 4
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

3 signals

Strengths

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Moderate predicted binding pocket FPocket selected-pocket score 0.68. This supports review but is not experimental validation. Structure available AlphaFold DB model

Risks / watch

No major risk signal surfaced in the loaded evidence.

Missing evidence

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
How to read this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal TPW pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Overview

Basic information about this protein and its source genome.

Accession
PA3094
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA3094
Status
annotated
Amino acids
345
3D evidence
AlphaFold DB model
GO
GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons. GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon. GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription. GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected pocket evidence

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.684
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MSAPRVRLGDLSVGFVQALADALLAAGVEPAPLLEQYGLDQRRLAEPGARLSIPRYMRLGHAAIQLSGDPALGLQMGRLSRLGQMGLAGVSVAQAPNLRAAARAMIHLEPLYAQNYRGQSSLVEDAGGAWLRFYSISPYNAYNRFVVDSVLAGWISHLGALARQPLKAERVDIEYPAPPWAERYEAFFGCPVEFGAPTNQLRLSQASLALANAEHCPSTWSQMLELCNRELEQLTRTRSWRERVSRLLGPMLNGREPDLEEVAARLKLPTWTLRRKLAEEGTQFRSILNDTRRDLAMVYIRETDLAFGEIAYLLGFASAEAFQRAFKRWSGQTPGEFRRAQRQSA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.

Sequence Features

Domain/signature hits from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
11 344 PANTHER PTHR47894 HTH-TYPE TRANSCRIPTIONAL REGULATOR GADX
235 345 Gene3D G3DSA:1.10.10.60 -
292 341 SUPERFAMILY SSF46689 Homeodomain-like
292 341 InterPro IPR009057 Homeobox-like domain superfamily
27 210 Pfam PF12625 Arabinose-binding domain of AraC transcription regulator, N-term
27 210 InterPro IPR032687 HTH-type transcriptional regulator AraC-type, N-terminal
262 339 Pfam PF12833 Helix-turn-helix domain
262 339 InterPro IPR018060 DNA binding HTH domain, AraC-type
322 338 PRINTS PR00032 AraC bacterial regulatory protein HTH signature
322 338 InterPro IPR020449 Transcription regulator HTH, AraC- type
307 322 PRINTS PR00032 AraC bacterial regulatory protein HTH signature
307 322 InterPro IPR020449 Transcription regulator HTH, AraC- type
242 340 ProSiteProfiles PS01124 Bacterial regulatory proteins, araC family DNA-binding domain profile.
242 340 InterPro IPR018060 DNA binding HTH domain, AraC-type
256 338 SMART SM00342 aracneu4
256 338 InterPro IPR018060 DNA binding HTH domain, AraC-type

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB PA3094
AlphaFold DB — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.684
2 0.366