Protein profile

PA3173

short-chain dehydrogenase

Genome: NC_002516.2

Gene: PA3173 Structure source: AlphaFold UniProt Q9HZ61
Amino acids 246
Annotations 1
Features 18
PDB binders 4
Druggability 0.627

Overview

Basic information about this protein and its source genome.

Accession
PA3173
Gene
PA3173
Status
annotated
Amino acids
246
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
32.847
Human E-value
5.84e-10
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.627
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MFQYSARPDLLKDRVILVTGAGRGIGAAAAKTFAAHGATVLLLGKTEEYLNEVYDAIEAAGHPQAAVIPFNLETAQPHQFEELAATLENEFGHIDGLLHNASILGPRSPMQQISGENFMRVMQVNVNAMFMLTTAMLPLMKLSSDASIIFTSSSVGRKGRAYWGAYSVSKFATEGLMQTLADELDGTSAIRANSVNPGATRTSMRALAYPGENPLNNPTGEEIMPVYLYLMGPDSAGVNGQAFDAQ

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

1
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Sequence Features

Domain/signature hits from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
12 243 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
12 243 InterPro IPR036291 NAD(P)-binding domain superfamily
153 181 ProSitePatterns PS00061 Short-chain dehydrogenases/reductases family signature.
153 181 InterPro IPR020904 Short-chain dehydrogenase/reductase, conserved site
188 205 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
188 205 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
140 156 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
140 156 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
166 185 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
166 185 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
92 103 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
92 103 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
15 32 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
15 32 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
2 242 PANTHER PTHR42901 ALCOHOL DEHYDROGENASE
15 207 Pfam PF00106 short chain dehydrogenase
15 207 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
2 245 Gene3D G3DSA:3.40.50.720 -

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3173
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.443
7 0.251

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

59 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
1PS Q5P8S7 201.2 Da LogP -0.09 TPSA 61.1 ✓ Ro5 ✓ Clean c1cc[n+](cc1)CCCS(=O)(=O)[O-]
A6O C0IR58 314.4 Da LogP 3.93 TPSA 46.5 ✓ Ro5 ✓ Clean CC[C@]1([C@H](CCC1=O)O)C/C=C/2\CCCc3c2ccc(c3)OC
HBR H9XP47 88.1 Da LogP -0.04 TPSA 37.3 ✓ Ro5 ✓ Clean C[C@H](C(=O)C)O
TAM C0IR58 163.2 Da LogP -1.17 TPSA 86.7 ✓ Ro5 ✓ Clean C(CO)C(CCO)(CCO)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.