Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA3201
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: yciB PA3201
Status: annotated
Amino acids: 195
Structure source: AlphaFold

GO

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.761

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MKQFIDFIPLILFFIVYKIDPQNVEFAGFNLSGIYGATATLILASVIVYGALWLKHRHLEKSQWFTLGACLVLGGLTLAFHEDTFLKWKAPLVNWLFALAFAGSHFIGDKPMIQRIMGHAIQLPQGLWVRLNIAWVVFFLVCGFANLYVVFTYPNFWVDFKVFGSLGMTLLFLIGQGLFLARHLHDADTGEKPKD

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Sequence Features

Domain/signature hits from InterPro and related databases.

28 records

Show feature table

Start	End	DB	Term	Name
53	63	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
34	52	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
7	14	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
128	150	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
182	195	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
63	80	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
151	161	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
31	53	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
15	18	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
92	108	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
162	181	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
129	150	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
1	6	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
1	194	PANTHER	PTHR36917	INTRACELLULAR SEPTATION PROTEIN A-RELATED
1	194	InterPro	IPR006008	Inner membrane-spanning protein YciB
1	18	Phobius	SIGNAL_PEPTIDE	Signal peptide region
162	184	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
92	108	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
64	80	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
1	187	Hamap	MF_00189	Membrane-spanning protein YciB [yciB].
1	187	InterPro	IPR006008	Inner membrane-spanning protein YciB
19	33	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1	185	Pfam	PF04279	Intracellular septation protein A
1	185	InterPro	IPR006008	Inner membrane-spanning protein YciB
109	128	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
81	91	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1	186	NCBIfam	TIGR00997	septation protein IspZ
1	186	InterPro	IPR006008	Inner membrane-spanning protein YciB

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA3201	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
2				0.761
1				0.508

PA3201