Overview
Basic information about this protein and its source genome.
- Accession
- PA3201
- Gene
- yciB PA3201
- Status
- annotated
- Amino acids
- 195
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- CytoplasmicMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKQFIDFIPLILFFIVYKIDPQNVEFAGFNLSGIYGATATLILASVIVYGALWLKHRHLEKSQWFTLGACLVLGGLTLAFHEDTFLKWKAPLVNWLFALAFAGSHFIGDKPMIQRIMGHAIQLPQGLWVRLNIAWVVFFLVCGFANLYVVFTYPNFWVDFKVFGSLGMTLLFLIGQGLFLARHLHDADTGEKPKD
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 53 | 63 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 34 | 52 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 7 | 14 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 128 | 150 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 182 | 195 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 63 | 80 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 151 | 161 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 31 | 53 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 15 | 18 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 92 | 108 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 162 | 181 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 129 | 150 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 6 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 1 | 194 | PANTHER | PTHR36917 | INTRACELLULAR SEPTATION PROTEIN A-RELATED |
| 1 | 194 | InterPro | IPR006008 | Inner membrane-spanning protein YciB |
| 1 | 18 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 162 | 184 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 92 | 108 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 64 | 80 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 187 | Hamap | MF_00189 | Membrane-spanning protein YciB [yciB]. |
| 1 | 187 | InterPro | IPR006008 | Inner membrane-spanning protein YciB |
| 19 | 33 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 185 | Pfam | PF04279 | Intracellular septation protein A |
| 1 | 185 | InterPro | IPR006008 | Inner membrane-spanning protein YciB |
| 109 | 128 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 81 | 91 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 1 | 186 | NCBIfam | TIGR00997 | septation protein IspZ |
| 1 | 186 | InterPro | IPR006008 | Inner membrane-spanning protein YciB |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA3201
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.761 | ||||||
| 1 | 0.508 |