Protein target profile

PA3222

hypothetical protein

Genome: NC_002516.2

Gene: PA3222 3D evidence: AlphaFold DB model UniProt Q9HZ18
Export view
Length 299
Pocket druggability 0.711
EC / GO 0 / 2
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

4 signals

Strengths

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Strong predicted binding pocket FPocket selected-pocket score 0.71. This is a computational pocket signal, not binding validation. Structure available AlphaFold DB model

Risks / watch

No major risk signal surfaced in the loaded evidence.

Missing evidence

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
How to read this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal TPW pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Overview

Basic information about this protein and its source genome.

Accession
PA3222
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA3222
Status
annotated
Amino acids
299
3D evidence
AlphaFold DB model
GO
GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it. GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
Hit
Essential (DEG)
N
Localization
CytoplasmicMembrane

Selected pocket evidence

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.711
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MNRRSALAALHGGALLFGLTGVFGKLASASPGVIVFGRALFAVLALGLFARLAGQAWRALGPAQWLRLALCGLLLAGHWVSFFIAVKTAGVAIATLGFASFPAFTVILEGLLFRERIHLAEGLLVVLVSLGLVLVTPNFDLASGATLGLLWAILSGLLFALLSLANRSNSGQVGPVQAALWQNLVVALCLLPFAVSELPALPALDWLWLALLGVFCTGLAHSLFVASLAVVKARTAALVFALEPVYGIAFAWLLFHETPGPRMFLGGALIILAIVLSARLGARGRKTAVGDERGDPERA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Sequence Features

Domain/signature hits from InterPro and related databases.

41 records
Show feature table
Start End DB Term Name
261 278 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
207 230 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
65 85 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
7 24 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
235 254 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
256 260 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
231 236 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
1 24 Phobius SIGNAL_PEPTIDE Signal peptide region
279 299 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
6 284 PANTHER PTHR42920 OS03G0707200 PROTEIN-RELATED
34 53 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
178 195 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
145 166 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
90 112 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
237 255 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
177 280 Gene3D G3DSA:1.10.3730.20 -
181 282 SUPERFAMILY SSF103481 Multidrug resistance efflux transporter EmrE
167 177 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
196 206 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
91 112 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
144 166 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
20 24 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
34 53 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 5 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
113 118 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
65 86 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
264 281 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
117 139 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
140 144 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
119 139 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
147 277 Pfam PF00892 EamA-like transporter family
147 277 InterPro IPR000620 EamA domain
12 135 Pfam PF00892 EamA-like transporter family
12 135 InterPro IPR000620 EamA domain
86 90 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
38 136 SUPERFAMILY SSF103481 Multidrug resistance efflux transporter EmrE
206 228 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
6 19 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
54 64 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
25 33 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
179 201 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB PA3222
AlphaFold DB — — full sequence — Viewing
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #2
0.711
Show in viewer
Site 2 FPocket #1
0.647
Show in viewer