Protein profile

PA3227

peptidyl-prolyl cis-trans isomerase A

Genome: NC_002516.2

Gene: cypH PA3227 ppiA Structure source: AlphaFold UniProt Q59641
Amino acids 187
Annotations 5
Features 27
PDB binders 40
Druggability 0.707

Overview

Basic information about this protein and its source genome.

Accession
PA3227
Gene
cypH PA3227 ppiA
Status
annotated
Amino acids
187
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
46.154
Human E-value
1.13e-10
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Periplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.707
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MLKRLLIAACTLLFAGSLLAATPAAKPHVLIATSLGEIEVELDPAKAPISVKNFLEYVDSGYYDGTLFHRVIPGFMVQTGGFSAGMQEKKTRAPIKNEADNGLLNERGTLAMARTGVVDSATSQFFINLTDNDFLNHGARDFGYAVFGKVVRGMGVVDQIAKVPTTRRNGFADVPSDDVVILSAKRL

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
  • GO:0003755 Catalysis of the reaction: peptidyl-proline (omega=180) = peptidyl-proline (omega=0).
  • GO:0006457 The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
  • GO:0000413 The modification of a protein by cis-trans isomerization of a proline residue.

Sequence Features

Domain/signature hits from InterPro and related databases.

27 records
Show feature table
Start End DB Term Name
29 186 InterPro IPR044665 Cyclophilin-type peptidyl-prolyl cis-trans isomerase, E. coli cyclophilin A-like
16 20 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 20 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
25 185 SUPERFAMILY SSF50891 Cyclophilin-like
25 185 InterPro IPR029000 Cyclophilin-like domain superfamily
63 80 ProSitePatterns PS00170 Cyclophilin-type peptidyl-prolyl cis-trans isomerase signature.
63 80 InterPro IPR020892 Cyclophilin-type peptidyl-prolyl cis-trans isomerase, conserved site
33 186 ProSiteProfiles PS50072 Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain profile.
33 186 InterPro IPR002130 Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain
5 15 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 20 SignalP_EUK SignalP-noTM SignalP-noTM
5 24 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
30 184 CDD cd01920 cyclophilin_EcCYP_like
21 187 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
142 157 PRINTS PR00153 Cyclophilin peptidyl-prolyl cis-trans isomerase signature
142 157 InterPro IPR002130 Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain
68 80 PRINTS PR00153 Cyclophilin peptidyl-prolyl cis-trans isomerase signature
68 80 InterPro IPR002130 Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain
42 57 PRINTS PR00153 Cyclophilin peptidyl-prolyl cis-trans isomerase signature
42 57 InterPro IPR002130 Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain
29 185 Pfam PF00160 Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
29 185 InterPro IPR002130 Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain
1 4 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
24 186 Gene3D G3DSA:2.40.100.10 -
24 186 InterPro IPR029000 Cyclophilin-like domain superfamily
29 186 PANTHER PTHR43246 PEPTIDYL-PROLYL CIS-TRANS ISOMERASE CYP38, CHLOROPLASTIC
1 20 Phobius SIGNAL_PEPTIDE Signal peptide region

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3227
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.707
4 0.304

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

190 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
76X P62937 109.1 Da LogP 0.25 TPSA 64.9 ✓ Ro5 ✓ Clean c1cc(c(nc1)N)N
78E P62937 554.7 Da LogP 2.68 TPSA 137.1 1 viol. ✓ Clean CC(C)[C@H]1C(=O)N[C@H](C(=O)N2CCC[C@H](N2)C(=O)…
78R P62937 634.8 Da LogP 3.26 TPSA 146.3 1 viol. ✓ Clean C[C@@H]1[C@@H](CC/C=C/c2cccc(c2)COC(=O)[C@@H]3C…
78X P62937 648.8 Da LogP 3.82 TPSA 146.3 1 viol. ✓ Clean C[C@@H]1c2cccc(c2)/C=C/CC[C@H]([C@H](C(=O)N[C@H…
7HG P62937 642.8 Da LogP 2.42 TPSA 155.5 1 viol. ✓ Clean C[C@H]1[C@H](/C=C/C=C/CCOC(=O)[C@@H]2CCCN(N2)C(…
838 P62937 556.7 Da LogP 2.89 TPSA 126.1 1 viol. ✓ Clean C[C@@H]1c2cccc(c2)/C=C/CC[C@H]([C@H](C(=O)N[C@H…
92Z P62937 110.1 Da LogP -0.17 TPSA 55.5 ✓ Ro5 ✓ Clean C1C=C(C(=O)N=C1)N
938 P62937 129.6 Da LogP 0.71 TPSA 51.8 ✓ Ro5 ✓ Clean c1c(c(ncn1)Cl)N
93B P62937 116.2 Da LogP -0.15 TPSA 24.1 ✓ Ro5 ✓ Clean C1CNC(=S)NC1
93E P62937 128.6 Da LogP 1.32 TPSA 38.9 ✓ Ro5 ✓ Clean c1cc(c(nc1)N)Cl
93K P62937 151.2 Da LogP -0.05 TPSA 95.1 ✓ Ro5 ✓ Clean c1cc(c(cc1C(=O)N)N)N
93Q P62937 108.1 Da LogP 0.97 TPSA 38.9 ✓ Ro5 ✓ Clean Cc1cccnc1N
EA4 P62937 251.3 Da LogP 0.63 TPSA 93.4 ✓ Ro5 Alert CCOC(=O)CNC(=O)NCc1ccc(cc1)N
F0Q P62937 527.4 Da LogP 2.63 TPSA 122.3 1 viol. Alert Cn1nc(nn1)CN(Cc2ccc(cc2)N)C(=O)NCC(=O)N3CCC[C@@…
F0T P62937 305.4 Da LogP 1.75 TPSA 84.7 ✓ Ro5 Alert CCOC(=O)CNC(=O)N(Cc1ccc(cc1)N)CC2CC2
F0W P62937 347.4 Da LogP 0.07 TPSA 128.3 ✓ Ro5 Alert CCOC(=O)CNC(=O)N(Cc1ccc(cc1)N)Cc2nnn(n2)C
F1E P62937 346.4 Da LogP 0.67 TPSA 115.4 ✓ Ro5 Alert CCOC(=O)CNC(=O)N(Cc1ccc(cc1)N)Cc2cn(nn2)C
F1Q P62937 333.4 Da LogP 0.06 TPSA 139.1 ✓ Ro5 Alert CCOC(=O)CNC(=O)N(Cc1ccc(cc1)N)Cc2[nH]nnn2
F1Z P62937 289.3 Da LogP 0.98 TPSA 84.7 ✓ Ro5 Alert CCOC(=O)CNC(=O)N(CC#C)Cc1ccc(cc1)N
L36 P62937 293.4 Da LogP 1.75 TPSA 84.7 ✓ Ro5 Alert CCCN(Cc1ccc(cc1)N)C(=O)NCC(=O)OCC
L60 P62937 100.1 Da LogP -0.31 TPSA 41.1 ✓ Ro5 ✓ Clean C1CNC(=O)NC1
L89 P62937 109.1 Da LogP 0.25 TPSA 64.9 ✓ Ro5 ✓ Clean c1cncc(c1N)N
L97 P62937 128.6 Da LogP 1.32 TPSA 38.9 ✓ Ro5 ✓ Clean c1cc(c(nc1)Cl)N
L99 P62937 166.2 Da LogP -0.55 TPSA 107.2 ✓ Ro5 ✓ Clean c1cc(c(cc1C(=O)NN)N)N
LSA P62937 183.2 Da LogP 0.12 TPSA 63.2 ✓ Ro5 ✓ Clean c1ccc2c(c1)C(=O)NS2(=O)=O
PE5 G0RY38 398.5 Da LogP 0.13 TPSA 94.1 ✓ Ro5 ✓ Clean CCOCCOCCOCCOCCOCCOCCOCCOCCO
PG5 Q8SRE1 178.2 Da LogP 0.31 TPSA 36.9 ✓ Ro5 ✓ Clean COCCOCCOCCOC
SFA P62937 1090.4 Da LogP 5.41 TPSA 273.4 4 viol. ✓ Clean CC[C@H]1C[C@@H]([C@@]2([C@H]([C@H]([C@H]([C@@H]…
SFM P62937 740.9 Da LogP 1.77 TPSA 214.8 3 viol. ✓ Clean C[C@H]1[C@H](/C=C/C=C/C[C@H](OC(=O)[C@@H]2CCCN(…
UMM P62937 546.7 Da LogP 2.47 TPSA 135.3 1 viol. ✓ Clean CC(C)[C@@H](C(=O)N[C@H]1Cc2cccc(c2)OCCCCOC(=O)[…
UNU P62937 121.1 Da LogP 0.79 TPSA 43.1 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)N
UO7 P62937 521.6 Da LogP 2.40 TPSA 129.7 1 viol. ✓ Clean C[C@@H]1c2ccc3cnc(cc3c2)/C=C/CC(=O)N[C@H](C(=O)…
UOD P62937 549.7 Da LogP 3.03 TPSA 129.7 1 viol. ✓ Clean C[C@@H]1c2ccc3ccc(cc3n2)/C=C/C(C(=O)N[C@H](C(=O…
UOG P62937 549.7 Da LogP 3.03 TPSA 129.7 1 viol. ✓ Clean C[C@@H]1c2ccc3ccc(cc3n2)/C=C/C(C(=O)O[C@H](C(=O…
UOJ P62937 561.7 Da LogP 3.18 TPSA 129.7 1 viol. ✓ Clean C[C@@H]1c2ccc3ccc(cc3n2)/C=C/C(C(=O)O[C@H](C(=O…
WM1 P62937 122.1 Da LogP 0.18 TPSA 56.0 ✓ Ro5 ✓ Clean c1ccnc(c1)C(=O)N
WM2 P62937 127.2 Da LogP 1.05 TPSA 43.1 ✓ Ro5 ✓ Clean C1CCC(CC1)C(=O)N
WM3 P62937 172.2 Da LogP -0.16 TPSA 72.2 ✓ Ro5 ✓ Clean c1ccc(cc1)S(=O)(=O)NN
WM4 P62937 136.2 Da LogP 0.29 TPSA 55.1 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)NN
ZXX P62937 448.5 Da LogP 0.25 TPSA 137.1 ✓ Ro5 ✓ Clean CC(C)[C@@H](C(=O)N[C@@H](Cc1cccc(c1)O)C(=O)N2CC…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.