Overview
Basic information about this protein and its source genome.
- Accession
- PA3232
- Gene
- PA3232
- Status
- annotated
- Amino acids
- 208
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MNTMVKLPDSRWPGWRRRLYWWMHEAVEAEEVISLDLETTSLDPRRADILSIGAVLVRRGKLVMGERLELYVEPPPSLDAESIRIHKLRRADLEGQLQLEQALRQVLAFIGDRPLLGYYLSFDVAVLNRHLRQLLDRQLHNPSIEISSLYHRKVSRHFPDAHIDLRFDTLARALDVPVSGRHTALGDAQAVALMFMRLLKGPAPKVIH
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
4- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0008408 Catalysis of the hydrolysis of ester linkages within nucleic acids by removing nucleotide residues from the 3' end.
- GO:0003676 Binding to a nucleic acid.
- GO:0006259 Any cellular metabolic process involving deoxyribonucleic acid. This is one of the two main types of nucleic acid, consisting of a long, unbranched macromolecule formed from one, or more commonly, two, strands of linked deoxyribonucleotides.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 22 | 201 | SUPERFAMILY | SSF53098 | Ribonuclease H-like |
| 22 | 201 | InterPro | IPR012337 | Ribonuclease H-like superfamily |
| 30 | 195 | PANTHER | PTHR30231 | DNA POLYMERASE III SUBUNIT EPSILON |
| 25 | 202 | Gene3D | G3DSA:3.30.420.10 | - |
| 25 | 202 | InterPro | IPR036397 | Ribonuclease H superfamily |
| 34 | 194 | Pfam | PF00929 | Exonuclease |
| 34 | 194 | InterPro | IPR013520 | Exonuclease, RNase T/DNA polymerase III |
| 33 | 196 | CDD | cd06127 | DEDDh |
| 31 | 204 | SMART | SM00479 | exoiiiendus |
| 31 | 204 | InterPro | IPR013520 | Exonuclease, RNase T/DNA polymerase III |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA3232
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 3 | 0.686 | ||||||
| 1 | 0.439 |