Protein profile

PA3248

hypothetical protein

Genome: NC_002516.2

Gene: PA3248 Structure source: AlphaFold UniProt Q9HYZ2
Amino acids 183
Annotations 4
Features 8
PDB binders 5
Druggability 0.681

Overview

Basic information about this protein and its source genome.

Accession
PA3248
Gene
PA3248
Status
annotated
Amino acids
183
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.681
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MFILPISSDLHLELLDQPRAEELFRLVRANSEHLAPWMPWVPLTQSVDDTRRFIGEGQRLWAERRSCRCGIVESGCLVGVIDLHDFTEDSRSASIGYWLAASAQGRGLLARALGKTIELGFLGYDRQRLVIRCSTENLRSQRAAERQGFRRDGVIRANEIIAGRAHDHAIYTLLRSEWHAAHA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:1990189 Catalysis of the reaction: acetyl-CoA + N-terminal L-seryl-[protein] = CoA + H+ + N-terminal Nalpha-acetyl-L-seryl-[protein].
  • GO:0008999 Catalysis of the reaction: acetyl-CoA + N-terminal L-alanyl-[protein] = CoA + H+ + N-terminal N(alpha)-acetyl-L-alanyl-[protein].
  • GO:0016747 Catalysis of the transfer of an acyl group, other than amino-acyl, from one compound (donor) to another (acceptor).

Sequence Features

Domain/signature hits from InterPro and related databases.

8 records
Show feature table
Start End DB Term Name
2 176 Gene3D G3DSA:3.40.630.30 -
5 174 SUPERFAMILY SSF55729 Acyl-CoA N-acyltransferases (Nat)
5 174 InterPro IPR016181 Acyl-CoA N-acyltransferase
20 150 Pfam PF13302 Acetyltransferase (GNAT) domain
20 150 InterPro IPR000182 GNAT domain
10 176 ProSiteProfiles PS51186 Gcn5-related N-acetyltransferase (GNAT) domain profile.
10 176 InterPro IPR000182 GNAT domain
8 181 PANTHER PTHR43441 RIBOSOMAL-PROTEIN-SERINE ACETYLTRANSFERASE

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3248
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.681
2 0.252

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

32 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
5NG A0R3G9 1533.1 Da LogP -2.80 TPSA 693.1 3 viol. ✓ Clean CC(C)(COP(=O)(O)OP(=O)(O)OC[C@@H]1[C@H]([C@H]([…
7MC Q47510 560.5 Da LogP -2.39 TPSA 276.4 3 viol. ✓ Clean CC(=O)N[C@@H](CC(=O)O)C(=O)N[P@@](=O)(OCCCN)OC[…
DSZ Q47510 461.4 Da LogP -3.79 TPSA 255.1 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
GSU Q47510 475.4 Da LogP -3.40 TPSA 255.1 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
MLA Q8ZPC0 104.1 Da LogP -0.45 TPSA 74.6 ✓ Ro5 ✓ Clean C(C(=O)O)C(=O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.