Protein profile

PA3280

pyrophosphate-specific outer membrane porin OprO

Genome: NC_002516.2

Gene: oprO PA3280 Structure source: Experimental + AlphaFold UniProt P32977
Export view
Amino acids 438
Annotations 4
Features 14
PDB binders 1
Druggability 0.563

Overview

Basic information about this protein and its source genome.

Accession
PA3280
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
oprO PA3280
Status
annotated
Amino acids
438
Structure source
Experimental + AlphaFold
GO
GO:0009279 A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures. GO:0046930 A protein complex providing a discrete opening in a membrane that allows the passage of gases and/or liquids. GO:0015288 Enables the transfer of substances, sized less than 1000 Da, from one side of a membrane to the other. The transmembrane portions of porins consist exclusively of beta-strands which form a beta-barrel. They are found in the outer membranes of Gram-negative bacteria, mitochondria, plastids and possibly acid-fast Gram-positive bacteria. GO:0006811 The directed movement of a monoatomic ion into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Monatomic ions (also called simple ions) are ions consisting of exactly one atom.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
OuterMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.563
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MIRKHSLGFVASALALAVSAQAFAGTVTTDGADIVIKTKGGLEVATTDKEFSFKLGGRLQADYSRFDGFYTKNGNTADAAYFRRAFIELGGTAYKDWKYQINFDLSHNTGSSDNGYFDEASVTYTGFNPVNLKFGRFDPDFGLEKATSSKWVTAPERNAAYELADWINTHQDGMGAQVNSTLADMAYLSAGVSAKDADDSDGDSVKQFNFRGVFAPMHEAGNVLHVGVNYAYRDLDDTAFDSRIRPRLGMRGIATSGGNDAGDNGNRATFGGVSNSPAGSYKDDSVWGLEGAWAMGPFSAQAEYLARKLKADDNAYKDIKAKGYYAQLAYTLTGESRQYKLEGAKFDSVKPENKEIGAWEVFYRYDNIKVEDDNVVADTATREVGDTKAKAHNLGVNWYVNDAVKISAAYVKAKTDKITNNNGDDDGDGFVTRLQYVF

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0009279 A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
  • GO:0046930 A protein complex providing a discrete opening in a membrane that allows the passage of gases and/or liquids.
  • GO:0015288 Enables the transfer of substances, sized less than 1000 Da, from one side of a membrane to the other. The transmembrane portions of porins consist exclusively of beta-strands which form a beta-barrel. They are found in the outer membranes of Gram-negative bacteria, mitochondria, plastids and possibly acid-fast Gram-positive bacteria.
  • GO:0006811 The directed movement of a monoatomic ion into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Monatomic ions (also called simple ions) are ions consisting of exactly one atom.

Sequence Features

Domain/signature hits from InterPro and related databases.

14 records
Show feature table
Start End DB Term Name
1 6 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
12 438 Gene3D G3DSA:2.40.160.10 Porin
12 438 InterPro IPR023614 Porin domain superfamily
1 22 SignalP_EUK SignalP-noTM SignalP-noTM
7 29 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
7 18 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
19 24 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
53 438 Pfam PF07396 Phosphate-selective porin O and P
53 438 InterPro IPR010870 Phosphate-selective porin O/P
1 24 Phobius SIGNAL_PEPTIDE Signal peptide region
1 24 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
25 438 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 24 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
49 438 SUPERFAMILY SSF56935 Porins

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

2 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 4RJW
X-ray 1.52 Å A
94.5% 25-438
PDBe RCSB PDBj File
Viewing
PDB 4RJX
X-ray 1.54 Å A
94.5% 25-438
PDBe RCSB PDBj File
Loaded
AlphaFold PA3280
AlphaFold — — full sequence — Loaded
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.448
2 0.405
19 0.389
13 0.255

Pockets (P2RANK)

Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).

P2RANK Sticks Spheres Surfaces Score Probability Labels Zoom Positions
1 47.71 0.976
2 7.23 0.376
3 2.67 0.078
4 2.05 0.045
5 1.31 0.014

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

51 records

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.

Show only:
Ligand Source crystal MW · LogP · TPSA Lipinski PAINS SMILES
C8E
4RJW 1.52 Å Open crystal
306.4 Da LogP 2.41 TPSA 57.2 ✓ Ro5 ✓ Clean CCCCCCCCOCCOCCOCCOCCO

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.