Protein profile

PA3285

ECF subfamily sigma-70 factor

Genome: NC_002516.2

Gene: PA3285 Structure source: AlphaFold UniProt Q9HYV8
Export view
Amino acids 203
Annotations 5
Features 16
PDB binders 1
Druggability 0.705

Overview

Basic information about this protein and its source genome.

Accession
PA3285
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA3285
Status
annotated
Amino acids
203
Structure source
AlphaFold
GO
GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid). GO:0016987 Sigma factors act as the promoter specificity subunit of eubacterial and plant plastid multisubunit RNA polymerases, whose core subunit composition is often described as alpha(2)-beta-beta-prime. Although sigma does not bind DNA on its own, when combined with the core to form the holoenzyme, the sigma factor binds specifically to promoter elements. The sigma subunit is released once elongation begins. GO:0006352 The initial step of transcription, consisting of the assembly of the RNA polymerase preinitiation complex (PIC) at a gene promoter, as well as the formation of the first few bonds of the RNA transcript. Transcription initiation includes abortive initiation events, which occur when the first few nucleotides are repeatedly synthesized and then released, and ends when promoter clearance takes place. GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription. GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.705
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MAAPTDAELLPRLLAGEQRAFRELVGAYQGAMRAVAWAIIGRSHTEEVVQDAWLAAVRGLDGFQGRSSLKTWLLTITANTAKSRLRQVRREVFLDDLPGPHGTVDDQRFAADGHWSQPPHAWHEDSPEALLTEGELRDCLDKTLNGLSELQRSVLTLRERQGLELEEIRDLLDITLSNVRVLLHRARLKVFATLEHFEETGQC

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Gene Ontology (GO)

5
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0016987 Sigma factors act as the promoter specificity subunit of eubacterial and plant plastid multisubunit RNA polymerases, whose core subunit composition is often described as alpha(2)-beta-beta-prime. Although sigma does not bind DNA on its own, when combined with the core to form the holoenzyme, the sigma factor binds specifically to promoter elements. The sigma subunit is released once elongation begins.
  • GO:0006352 The initial step of transcription, consisting of the assembly of the RNA polymerase preinitiation complex (PIC) at a gene promoter, as well as the formation of the first few bonds of the RNA transcript. Transcription initiation includes abortive initiation events, which occur when the first few nucleotides are repeatedly synthesized and then released, and ends when promoter clearance takes place.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.

Sequence Features

Domain/signature hits from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
24 90 Pfam PF04542 Sigma-70 region 2
24 90 InterPro IPR007627 RNA polymerase sigma-70 region 2
3 97 SUPERFAMILY SSF88946 Sigma2 domain of RNA polymerase sigma factors
3 97 InterPro IPR013325 RNA polymerase sigma factor, region 2
119 194 SUPERFAMILY SSF88659 Sigma3 and sigma4 domains of RNA polymerase sigma factors
119 194 InterPro IPR013324 RNA polymerase sigma factor, region 3/4-like
3 199 PANTHER PTHR43133 RNA POLYMERASE ECF-TYPE SIGMA FACTO
3 199 InterPro IPR039425 RNA polymerase sigma-70 like
2 101 Gene3D G3DSA:1.10.1740.10 -
20 189 NCBIfam TIGR02937 sigma-70 family RNA polymerase sigma factor
20 189 InterPro IPR014284 RNA polymerase sigma-70 like domain
137 190 CDD cd06171 Sigma70_r4
119 197 Gene3D G3DSA:1.10.10.10 -
119 197 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
137 189 Pfam PF08281 Sigma-70, region 4
137 189 InterPro IPR013249 RNA polymerase sigma factor 70, region 4 type 2

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3285
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
9 0.705
2 0.543

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

51 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
NCA
6IN7
Q06198 122.1 Da LogP 0.18 TPSA 56.0 ✓ Ro5 ✓ Clean c1cc(cnc1)C(=O)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.