Protein profile

PA3292

hypothetical protein

Genome: NC_002516.2

Gene: PA3292 Structure source: AlphaFold UniProt Q9HYV1
Amino acids 285
Annotations 0
Features 11
PDB binders 0
Druggability 0.752

Overview

Basic information about this protein and its source genome.

Accession
PA3292
Gene
PA3292
Status
annotated
Amino acids
285
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.752
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MNGRGIGLPALLPGPLLAASCQSGPDMLAAPVMGYNHTSAAINWFSVNGAGGPRLGPYQGDGSQVCCGVIPKKWNPNLKAVVEWEKDPKPHAAIRRDKYGRLDKDDYLRHASSYTRHKMIVDIPRYSEKICLLQVHFLPCDQVAVSTTYYSQGHPEYPVRKYFQKREPSCKKLLNAKGLRTPDWLIALLIGFLFLQACQAGSDMVSTPIGGYNHTSAAINRFSVNGAGGLNLGPFQGGAGQVCCGVVPRVWKSGLKATVEWEVVPEPGAYKDWPERYFQMAGENV

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

11 records
Show feature table
Start End DB Term Name
5 12 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 18 Phobius SIGNAL_PEPTIDE Signal peptide region
212 275 Pfam PF11745 Protein of unknown function (DUF3304)
212 275 InterPro IPR021733 Protein of unknown function DUF3304
35 145 Pfam PF11745 Protein of unknown function (DUF3304)
35 145 InterPro IPR021733 Protein of unknown function DUF3304
1 4 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
13 18 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 18 SignalP_EUK SignalP-noTM SignalP-noTM
1 21 ProSiteProfiles PS51257 Prokaryotic membrane lipoprotein lipid attachment site profile.
19 285 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3292
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.752
2 0.217