Protein profile

PA3295

HIT family protein

Genome: NC_002516.2

Gene: PA3295 Structure source: AlphaFold UniProt Q9HYU8
Amino acids 145
Annotations 3
Features 18
PDB binders 28
Druggability 0.705

Overview

Basic information about this protein and its source genome.

Accession
PA3295
Gene
PA3295
Status
annotated
Amino acids
145
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
53.659
Human E-value
4.21e-07
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.705
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MSLHGVYDSQNIFAKIIRGEAPCYKVYEDEDVLAFLDLFPQSYGHTLVIPKHAEARNLLEIEAQNLVKVMAVVQRLTRALVEEVQPDGVQVAQFNGAPAGQTVFHIHFHVIPRFSGENLGIHAAKQGDPEVLAQLQERLAQRLQG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0016787 Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc.
  • GO:0003824 Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.

Sequence Features

Domain/signature hits from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
11 113 CDD cd01277 HINT_subgroup
11 113 InterPro IPR039384 HINT family
5 143 Gene3D G3DSA:3.30.428.10 -
5 143 InterPro IPR036265 HIT-like superfamily
12 120 ProSiteProfiles PS51084 HIT domain profile.
12 120 InterPro IPR011146 HIT-like domain
101 111 PRINTS PR00332 Histidine triad family signature
101 111 InterPro IPR001310 Histidine triad (HIT) protein
12 28 PRINTS PR00332 Histidine triad family signature
12 28 InterPro IPR001310 Histidine triad (HIT) protein
33 51 PRINTS PR00332 Histidine triad family signature
33 51 InterPro IPR001310 Histidine triad (HIT) protein
7 144 PANTHER PTHR46648 HIT FAMILY PROTEIN 1
7 144 InterPro IPR001310 Histidine triad (HIT) protein
6 142 SUPERFAMILY SSF54197 HIT-like
6 142 InterPro IPR036265 HIT-like superfamily
18 114 Pfam PF01230 HIT domain
18 114 InterPro IPR011146 HIT-like domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3295
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.705
2 0.371

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

92 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
5AS P80912 374.4 Da LogP -2.10 TPSA 174.7 1 viol. ✓ Clean CCNS(=O)(=O)OC[C@@H]1[C@H]([C@H](C(O1)n2cnc3c2n…
5GP P80912 363.2 Da LogP -2.57 TPSA 206.0 1 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)COP(=O)(O…
6CE P49773 521.5 Da LogP 0.47 TPSA 204.4 2 viol. ✓ Clean c1ccc2c(c1)c(c[nH]2)CCNP(=O)(O)SC[C@@H]3[C@H]([…
6CG P49773 379.3 Da LogP -1.85 TPSA 196.8 1 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CSP(=O)(O…
6UR P49773 489.4 Da LogP 0.46 TPSA 193.7 1 viol. ✓ Clean c1ccc2c(c1)c(c[nH]2)CCNP(=O)(O)OC[C@@H]3[C@H]([…
6US P49773 489.4 Da LogP 0.46 TPSA 193.7 1 viol. ✓ Clean c1ccc2c(c1)c(c[nH]2)CCNP(=O)(O)OC[C@@H]3[C@H]([…
6UT P49773 562.5 Da LogP -1.13 TPSA 242.7 3 viol. ✓ Clean CNC(=O)[C@H](Cc1c[nH]c2c1cccc2)NP(=O)(O)OC[C@@H…
6UU P49773 240.2 Da LogP 1.39 TPSA 85.4 ✓ Ro5 ✓ Clean c1ccc2c(c1)c(c[nH]2)CCNP(=O)(O)O
777 P49773 390.3 Da LogP -1.95 TPSA 197.8 1 viol. ✓ Clean CCNP(=O)(O)OC[C@@H]1[C@H]([C@H]([C@@H](O1)n2cnc…
8BR P80912 426.1 Da LogP -1.10 TPSA 186.1 ✓ Ro5 ✓ Clean c1nc(c2c(n1)n(c(n2)Br)[C@H]3[C@@H]([C@@H]([C@H]…
9ZA P49773 432.3 Da LogP -1.70 TPSA 204.2 1 viol. ✓ Clean C[C@@H](C(=O)OC)NP(=O)(O)OC[C@@H]1[C@H]([C@H]([…
9ZD P49773 432.3 Da LogP -1.70 TPSA 204.2 1 viol. ✓ Clean C[C@H](C(=O)OC)NP(=O)(O)OC[C@@H]1[C@H]([C@H]([C…
A5A P49773 417.4 Da LogP -3.25 TPSA 217.8 1 viol. ✓ Clean C[C@@H](C(=O)NS(=O)(=O)OC[C@@H]1[C@H]([C@H]([C@…
ADN A3DF72 267.2 Da LogP -1.98 TPSA 139.5 ✓ Ro5 ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ADW P49773 732.9 Da LogP -3.47 TPSA 232.6 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
AP5 P49773 916.4 Da LogP -2.33 TPSA 480.5 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
B4P P49773 836.4 Da LogP -2.45 TPSA 434.0 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
D5M P49773 331.2 Da LogP -0.83 TPSA 165.8 ✓ Ro5 ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3C[C@@H]([C@H](O3)COP(=O…
ESA P49773 110.1 Da LogP -0.11 TPSA 54.4 ✓ Ro5 ✓ Clean CCS(=O)(=O)O
IMP P49773 348.2 Da LogP -2.15 TPSA 180.0 ✓ Ro5 ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)COP(=O)(O…
IU P49773 450.1 Da LogP -2.13 TPSA 171.3 ✓ Ro5 ✓ Clean C1=C(C(=O)NC(=O)N1[C@H]2[C@@H]([C@@H]([C@H](O2)…
JB6 P49773 796.7 Da LogP -1.04 TPSA 329.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
KAA P49773 474.5 Da LogP -3.14 TPSA 243.8 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
KB7 P49773 354.3 Da LogP -1.93 TPSA 177.6 ✓ Ro5 ✓ Clean CCNC(=O)OC[C@@H]1[C@H]([C@H]([C@@H](O1)n2cnc3c2…
KBD P49773 416.4 Da LogP -0.75 TPSA 177.6 ✓ Ro5 ✓ Clean c1ccc(cc1)CNC(=O)OC[C@@H]2[C@H]([C@H]([C@@H](O2…
KBJ P49773 430.4 Da LogP -0.71 TPSA 177.6 ✓ Ro5 ✓ Clean c1ccc(cc1)CCNC(=O)OC[C@@H]2[C@H]([C@H]([C@@H](O…
LMR P49773 134.1 Da LogP -1.09 TPSA 94.8 ✓ Ro5 ✓ Clean C([C@@H](C(=O)O)O)C(=O)O
WSA P49773 532.5 Da LogP -1.54 TPSA 233.6 3 viol. ✓ Clean c1ccc2c(c1)c(c[nH]2)C[C@@H](C(=O)NS(=O)(=O)OC[C…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.