Overview
Basic information about this protein and its source genome.
- Accession
- PA3348
- Gene
- PA3348 cheR1
- Status
- annotated
- Amino acids
- 274
- Structure source
- Experimental + AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSAANADFELFRVFLEKTCGIVLGSNKQYLVSSRLNKLMEQQGIKSLGELVQRIQTQRGGLREMVVDAMTTNETLWFRDTYPFEVLKQRVLPELIKANGGQRLRIWSAACSSGQEPYSLSMAIDEFEKTNLGQLKAGVQIVATDLSGSMLTAAKAGEYDTLAMGRGLSPERLQRYFDAKGPGRWAVKPAIRSRVEFRALNLLDSYASLGKFDMVFCRNVLIYFSAEVKRDILLRIHGTLKPGGYLFLGASEALNNLPDHYQMVQCSPGIIYRAK
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
4- GO:0008276 Catalysis of the transfer of a methyl group (CH3-) to a protein.
- GO:0008983 Catalysis of the reaction: S-adenosyl-L-methionine + protein L-glutamate = S-adenosyl-L-homocysteine + protein L-glutamate 5-methyl ester; this reaction is the methylation of peptidyl-L-glutamate to form peptidyl-L-glutamate 5-methyl ester.
- GO:0032259 The process in which a methyl group is covalently attached to a molecule.
- GO:0008757 Catalysis of the transfer of a methyl group from S-adenosyl-L-methionine to a substrate.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 27 | 40 | PRINTS | PR00996 | Glutamate methyltransferase family signature |
| 27 | 40 | InterPro | IPR000780 | MCP methyltransferase, CheR-type |
| 104 | 124 | PRINTS | PR00996 | Glutamate methyltransferase family signature |
| 104 | 124 | InterPro | IPR000780 | MCP methyltransferase, CheR-type |
| 230 | 253 | PRINTS | PR00996 | Glutamate methyltransferase family signature |
| 230 | 253 | InterPro | IPR000780 | MCP methyltransferase, CheR-type |
| 65 | 77 | PRINTS | PR00996 | Glutamate methyltransferase family signature |
| 65 | 77 | InterPro | IPR000780 | MCP methyltransferase, CheR-type |
| 142 | 158 | PRINTS | PR00996 | Glutamate methyltransferase family signature |
| 142 | 158 | InterPro | IPR000780 | MCP methyltransferase, CheR-type |
| 211 | 225 | PRINTS | PR00996 | Glutamate methyltransferase family signature |
| 211 | 225 | InterPro | IPR000780 | MCP methyltransferase, CheR-type |
| 72 | 267 | Pfam | PF01739 | CheR methyltransferase, SAM binding domain |
| 72 | 267 | InterPro | IPR022642 | MCP methyltransferase, CheR-type, SAM-binding domain, C-terminal |
| 7 | 264 | PANTHER | PTHR24422 | CHEMOTAXIS PROTEIN METHYLTRANSFERASE |
| 1 | 274 | PIRSF | PIRSF000410 | CheR |
| 1 | 274 | InterPro | IPR026024 | Chemotaxis protein methyltransferase CheR |
| 6 | 56 | Pfam | PF03705 | CheR methyltransferase, all-alpha domain |
| 6 | 56 | InterPro | IPR022641 | Chemotaxis receptor methyltransferase CheR, N-terminal |
| 1 | 274 | ProSiteProfiles | PS50123 | CheR-type methyltransferase domain profile. |
| 1 | 274 | InterPro | IPR000780 | MCP methyltransferase, CheR-type |
| 4 | 71 | SUPERFAMILY | SSF47757 | Chemotaxis receptor methyltransferase CheR, N-terminal domain |
| 1 | 70 | Gene3D | G3DSA:1.10.155.10 | - |
| 1 | 70 | InterPro | IPR036804 | Chemotaxis receptor methyltransferase CheR, N-terminal domain superfamily |
| 5 | 271 | SMART | SM00138 | methyl_trans_3 |
| 5 | 271 | InterPro | IPR000780 | MCP methyltransferase, CheR-type |
| 191 | 247 | CDD | cd02440 | AdoMet_MTases |
| 72 | 265 | SUPERFAMILY | SSF53335 | S-adenosyl-L-methionine-dependent methyltransferases |
| 72 | 265 | InterPro | IPR029063 | S-adenosyl-L-methionine-dependent methyltransferase superfamily |
| 71 | 272 | Gene3D | G3DSA:3.40.50.150 | Vaccinia Virus protein VP39 |
| 71 | 272 | InterPro | IPR029063 | S-adenosyl-L-methionine-dependent methyltransferase superfamily |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
4 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
PDB
5XLY
|
X-ray | 1.76 Å | A |
|
Viewing | |
|
PDB
5XLX
|
X-ray | 1.97 Å | A,B,C,D |
|
Loaded | |
|
PDB
5Y4R
|
X-ray | 2.30 Å | A,B |
|
Loaded | |
|
PDB
5Y4S
|
X-ray | 3.40 Å | A,B,C,D,E,F,G,H,I,J |
|
Loaded | |
|
AlphaFold
PA3348
|
AlphaFold | — | — | full sequence | — | Loaded |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (P2RANK)
Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).
| P2RANK | Sticks | Spheres | Surfaces | Score | Probability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|---|
| 1 | 4.3 | 0.178 | ||||||
| 2 | 3.41 | 0.122 |
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.697 | ||||||
| 2 | 0.412 | ||||||
| 5 | 0.303 | ||||||
| 11 | 0.256 |