Overview
Basic information about this protein and its source genome.
- Accession
- PA3352
- Gene
- PA3352
- Status
- annotated
- Amino acids
- 156
- Structure source
- Experimental + AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MPDSPTLLDLFAEDIGHANQLLQLVDEEFQALERRELPVLQQLLGAKQPLMQQLERNGRARAEILREAGVSLDREGLARYARERADGAELLARGDELGELLERCQQANLRNGRIIRANQASTGSLLNILRGQDAPSLYDSRGGTASSSRQRPLSQA
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0044780 The assembly of a bacterial-type flagellum, a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope which functions in cell motility.
- GO:0005515 Binding to a protein.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 136 | 156 | MobiDBLite | mobidb-lite | consensus disorder prediction |
| 2 | 145 | Pfam | PF05130 | FlgN protein |
| 2 | 145 | InterPro | IPR007809 | FlgN-like protein |
| 139 | 156 | MobiDBLite | mobidb-lite | consensus disorder prediction |
| 6 | 130 | SUPERFAMILY | SSF140566 | FlgN-like |
| 6 | 130 | InterPro | IPR036679 | FlgN-like superfamily |
| 1 | 130 | Gene3D | G3DSA:1.20.58.300 | - |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
1 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.682 |
Pockets (P2RANK)
Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).
| P2RANK | Sticks | Spheres | Surfaces | Score | Probability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|---|
| 1 | 5.88 | 0.288 |
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.945 |