Protein profile

PA3441

molybdopterin-binding protein

Genome: NC_002516.2

Gene: PA3441 Structure source: AlphaFold UniProt Q9HYG5
Amino acids 71
Annotations 1
Features 9
PDB binders 2
Druggability 0.684

Overview

Basic information about this protein and its source genome.

Accession
PA3441
Gene
PA3441
Status
annotated
Amino acids
71
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.684
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MTIKAINVRNQFKGTVKEIIEGPVLSEIDVQTAAGIVTSVITTRSVKELELAIGSEVIAFVKSTEVSIAKL

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

1
  • GO:0015689 The directed movement of molybdate (MoO4 2-) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Molybdate is the bivalent anion derived from molybdic acid.

Sequence Features

Domain/signature hits from InterPro and related databases.

9 records
Show feature table
Start End DB Term Name
5 70 Gene3D G3DSA:2.40.50.100 -
8 67 Pfam PF03459 TOBE domain
8 67 InterPro IPR005116 Transport-associated OB, type 1
6 69 SUPERFAMILY SSF50331 MOP-like
6 69 InterPro IPR008995 Molybdate/tungstate binding, C-terminal
7 69 NCBIfam TIGR00638 molybdenum-pterin binding domain
7 69 InterPro IPR004606 Molybdenum-pterin binding domain
5 70 ProSiteProfiles PS51866 Mop domain profile.
5 70 InterPro IPR004606 Molybdenum-pterin binding domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3441
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.684

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

2 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
MOO P08854 159.9 Da LogP -2.62 TPSA 80.3 ✓ Ro5 ✓ Clean [O-][Mo](=O)(=O)[O-]
WO4 P08854 247.8 Da LogP -2.62 TPSA 80.3 ✓ Ro5 ✓ Clean [O-][W](=O)(=O)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.