Protein profile

PA3444

alkanesulfonate monooxygenase

Genome: NC_002516.2

Gene: PA3444 ssuD Structure source: AlphaFold UniProt Q9HYG2
Amino acids 382
Annotations 4
Features 13
PDB binders 6
Druggability 0.673

Overview

Basic information about this protein and its source genome.

Accession
PA3444
Gene
PA3444 ssuD
Status
annotated
Amino acids
382
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.673
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MSLEIFWFLPTHGDGHYLGTTQGARAVDHGYLQQIAQAADRLGFGGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTVAARQAATLDRLSNGRALFNLVTGGDPDELAGDGLHLSHAERYEASVEFTRIWRRVLEGETVDYAGKHIQVKGAKLLYPPLQQPRPPLYFGGSSEAAQDLAAEQVELYLTWGEPPAAVAEKIAQVREKAARQGRQVRFGIRLHVIVRETSEEAWQAADRLIAHLDDDTIARAQASLARFDSVGQQRMAALHGGSRDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVREYAELGIDTFIFSGYPHLEESYRVAELLFPHLDVQRPAQPEGRGYVSPFGEMVANDILPRQAAQS

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 3 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

3
  • GO:0008726 Catalysis of the reaction: an alkanesulfonate + O2 + FMNH2 = an aldehyde + sulfite + H2O + FMN.
  • GO:0046306 The chemical reactions and pathways resulting in the breakdown of alkanesulfonates, the anion of alkanesulfonic acids, sulfonic acid derivatives containing an aliphatic hydrocarbon group.
  • GO:0016705 Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced or incorporated into a donor.

Sequence Features

Domain/signature hits from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
3 245 CDD cd01094 Alkanesulfonate_monoxygenase
1 360 FunFam G3DSA:3.20.20.30:FF:000001 Alkanesulfonate monooxygenase
3 349 SUPERFAMILY SSF51679 Bacterial luciferase-like
3 349 InterPro IPR036661 Luciferase-like domain superfamily
1 357 Gene3D G3DSA:3.20.20.30 -
1 357 InterPro IPR036661 Luciferase-like domain superfamily
4 349 NCBIfam TIGR03565 FMNH2-dependent alkanesulfonate monooxygenase
4 349 InterPro IPR019911 Alkanesulphonate monooxygenase, FMN-dependent
3 379 Hamap MF_01229 Alkanesulfonate monooxygenase [ssuD].
3 379 InterPro IPR019911 Alkanesulphonate monooxygenase, FMN-dependent
2 353 PANTHER PTHR42847 ALKANESULFONATE MONOOXYGENASE
4 326 Pfam PF00296 Luciferase-like monooxygenase
4 326 InterPro IPR011251 Luciferase-like domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3444
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.673

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

56 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
03S Q3K9A1 96.1 Da LogP -0.50 TPSA 54.4 ✓ Ro5 ✓ Clean CS(=O)(=O)O
9WY A0A3B6UEK8 456.3 Da LogP -1.61 TPSA 208.1 1 viol. ✓ Clean Cc1cc2c(cc1C)N(C3=NC(=O)NC(=O)C3=N2)CC([C@@H]([…
LFN O34974 256.3 Da LogP 0.74 TPSA 80.6 ✓ Ro5 ✓ Clean Cc1cc2c(cc1C)N(C3=NC(=O)NC(=O)C3=N2)C
RBF A0A3B6UEK8 376.4 Da LogP -1.72 TPSA 161.6 ✓ Ro5 ✓ Clean Cc1cc2c(cc1C)N(C3=NC(=O)NC(=O)C3=N2)C[C@@H]([C@…
SIN Q3K9A1 118.1 Da LogP -0.06 TPSA 74.6 ✓ Ro5 ✓ Clean C(CC(=O)O)C(=O)O
URA P75898 112.1 Da LogP -0.94 TPSA 65.7 ✓ Ro5 ✓ Clean C1=CNC(=O)NC1=O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.