Target candidate with partial support; inspect missing evidence before prioritizing.
4 signalsStrengths
Risks / watch
How to read this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal TPW pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Overview
Basic information about this protein and its source genome.
- Accession
- PA3454
- Gene
- PA3454
- Status
- annotated
- Amino acids
- 394
- 3D evidence
- Experimental + AlphaFold DB model
Target profile
Computed evidence for target prioritization.
- Human off-target
- hit
- Human identity (%)
- 45.78
- Human E-value
- 5.020000000000001e-103
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Cytoplasmic
Selected pocket evidence
The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MREVVIVDSVRTGLAKSFRGKFNLTRPDDMAAHCVDALLARNDLDPLLVDDCIVGAGSNEGAQGHNIGRNVAVLSGLGIQVPGMTLNRYCSSGLQAIAIAANQIASGCSEVIVAGGVESITLTLKSVNTDHLVNPLLQREVPGIYYPMGQTAEIVARRYGITREAQDAYALQSQQRMARAQADGLFADEIVPMTTRYAVEDKASGEKQVLDGVVDRDDCNRPDTTLEGLASLKPAFAEDGSVTAGNASQLSDGASMTLLMSLEKALALGLEPKAFFRGFTVAGCEPDEMGIGPVFSVPKLLKAKGLKIADVDLWELNEAFASQCLYCRDRLEIDNEKYNVNGGSIAIGHPFGMTGSRQVGHLVRELHRRNLRYGVVTMCVGGGMGASGLFEAVR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
7- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
- GO:0033812 Catalysis of the reaction: succinyl-CoA + acetyl-CoA = CoA + 3-oxoadipyl-CoA.
- GO:0003988 Catalysis of the reaction: acyl-CoA + acetyl-CoA = CoA + 3-oxoacyl-CoA.
- GO:0006635 A fatty acid oxidation process that results in the complete oxidation of a long-chain fatty acid. Fatty acid beta-oxidation begins with the addition of coenzyme A to a fatty acid, and occurs by successive cycles of reactions during each of which the fatty acid is shortened by a two-carbon fragment removed as acetyl coenzyme A; the cycle continues until only two or three carbons remain (as acetyl-CoA or propionyl-CoA respectively).
- GO:0010124 The chemical reactions and pathways resulting in the breakdown of phenylacetate.
- GO:0016746 Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
- GO:0016747 Catalysis of the transfer of an acyl group, other than amino-acyl, from one compound (donor) to another (acceptor).
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 5 | 392 | CDD | cd00751 | thiolase |
| 5 | 392 | InterPro | IPR002155 | Thiolase |
| 271 | 391 | SUPERFAMILY | SSF53901 | Thiolase-like |
| 271 | 391 | InterPro | IPR016039 | Thiolase-like |
| 86 | 104 | ProSitePatterns | PS00098 | Thiolases acyl-enzyme intermediate signature. |
| 86 | 104 | InterPro | IPR020615 | Thiolase, acyl-enzyme intermediate active site |
| 4 | 276 | Gene3D | G3DSA:3.40.47.10 | - |
| 4 | 276 | InterPro | IPR016039 | Thiolase-like |
| 1 | 393 | FunFam | G3DSA:3.40.47.10:FF:000010 | Acetyl-CoA acetyltransferase (Thiolase) |
| 2 | 393 | PANTHER | PTHR43853 | 3-KETOACYL-COA THIOLASE, PEROXISOMAL |
| 1 | 394 | PIRSF | PIRSF000429 | Ac-CoA_Ac_transf |
| 1 | 394 | InterPro | IPR002155 | Thiolase |
| 126 | 386 | Gene3D | G3DSA:3.40.47.10 | - |
| 126 | 386 | InterPro | IPR016039 | Thiolase-like |
| 271 | 391 | Pfam | PF02803 | Thiolase, C-terminal domain |
| 271 | 391 | InterPro | IPR020617 | Thiolase, C-terminal |
| 374 | 387 | ProSitePatterns | PS00099 | Thiolases active site. |
| 374 | 387 | InterPro | IPR020610 | Thiolase, active site |
| 1 | 265 | SUPERFAMILY | SSF53901 | Thiolase-like |
| 1 | 265 | InterPro | IPR016039 | Thiolase-like |
| 339 | 355 | ProSitePatterns | PS00737 | Thiolases signature 2. |
| 339 | 355 | InterPro | IPR020613 | Thiolase, conserved site |
| 6 | 391 | NCBIfam | TIGR01930 | acetyl-CoA C-acyltransferase |
| 6 | 391 | InterPro | IPR002155 | Thiolase |
| 4 | 261 | Pfam | PF00108 | Thiolase, N-terminal domain |
| 4 | 261 | InterPro | IPR020616 | Thiolase, N-terminal |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
Loading 3D structure...
Structural evidence
1 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.513 | ||||||
| 2 | 0.512 | ||||||
| 3 | 0.267 |
Pockets (P2RANK)
Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).
| P2RANK | Sticks | Spheres | Surfaces | Score | Probability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|---|
| 1 | 8.23 | 0.438 | ||||||
| 2 | 2.61 | 0.075 | ||||||
| 3 | 2.55 | 0.072 | ||||||
| 4 | 1.85 | 0.036 | ||||||
| 5 | 0.88 | 0.004 |
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 5 | 0.549 | ||||||
| 1 | 0.49 | ||||||
| 2 | 0.323 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 168 RCSB PDB | P07097 | 388.5 Da LogP 0.15 TPSA 131.0 | ✓ Ro5 | ✓ Clean |
CC(=O)OCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COC(=O)C(C…
|
|
| 1VU RCSB PDB | F1KYX0 | 823.6 Da LogP -0.93 TPSA 363.6 | 3 viol. | ✓ Clean |
CCC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)COP(=O)(O…
|
|
| 5UG RCSB PDB | P76461 | 438.3 Da LogP -0.85 TPSA 191.7 | 1 viol. | ✓ Clean |
CC(C)(COP(=O)(O)OP(=O)(O)O)[C@@H](C(=O)NCCC(=O)…
|
|
| CAA RCSB PDB | P07097 | 851.6 Da LogP -1.36 TPSA 380.7 | 3 viol. | ✓ Clean |
CC(=O)CC(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P…
|
|
| COZ RCSB PDB | P76461 | 767.5 Da LogP -1.67 TPSA 346.6 | 3 viol. | ✓ Clean |
CC(C)(CO[P@](=O)(O)O[P@](=O)(O)OC[C@@H]1[C@H]([…
|
|
| DNO RCSB PDB | P07097 | 180.2 Da LogP -3.38 TPSA 118.2 | ✓ Ro5 | ✓ Clean |
C([C@H]([C@H]([C@@H]([C@@H](C=O)O)O)O)O)O
|
|
| DTT RCSB PDB | P42765 | 154.3 Da LogP -0.43 TPSA 40.5 | ✓ Ro5 | ✓ Clean |
C([C@@H]([C@H](CS)O)O)S
|
|
| O8Y RCSB PDB | Q88N39 | 100.2 Da LogP 1.77 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CCCCCC=O
|
|
| OPI RCSB PDB | P07097 | 346.4 Da LogP -0.42 TPSA 125.0 | ✓ Ro5 | ✓ Clean |
CC(C)(C)C(=O)OCC(C)(C)[C@H](C(=O)NCCC(=O)NCCO)O
|
|
| OYA RCSB PDB | Q88N39 | 128.2 Da LogP 2.55 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCC=O
|
|
| PN5 RCSB PDB | P07097 | 362.5 Da LogP 0.52 TPSA 104.7 | ✓ Ro5 | ✓ Clean |
CC(C)(C)C(=O)OCC(C)(C)[C@H](C(=O)NCCC(=O)NCCS)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC100056793 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)CO
|
| ZINC100056796 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@H](O)CO
|
| ZINC12953159 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@H](O)[C@H](O)[C@@H](O)CO
|
| ZINC12953162 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO
|
| ZINC12953168 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)CO
|
| ZINC13522675 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@H](O)[C@H](O)[C@H](O)CO
|
| ZINC13522684 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)CO
|
| ZINC4353166 ZINC | 0.950 | 240.2 Da LogP -4.66 TPSA 158.7 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O…
|
| ZINC4353167 ZINC | 0.950 | 240.2 Da LogP -4.66 TPSA 158.7 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O…
|
| ZINC4353168 ZINC | 0.950 | 240.2 Da LogP -4.66 TPSA 158.7 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)…
|
| ZINC4353169 ZINC | 0.950 | 240.2 Da LogP -4.66 TPSA 158.7 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)…
|
| ZINC4353180 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O…
|
| ZINC4353181 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)…
|
| ZINC4353182 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)…
|
| ZINC95884213 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)CO
|
| ZINC9915770 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@H](O)[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO
|
| ZINC9915771 ZINC | 0.950 | 210.2 Da LogP -4.02 TPSA 138.5 | 1 viol. | ✓ Clean |
O=C[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO
|
| ZINC1693894 ZINC | 0.938 | 212.4 Da LogP 4.89 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCCC=O
|
| ZINC43061660 ZINC | 0.789 | 210.4 Da LogP 4.66 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C\CCCCCC=O
|
| ZINC43061664 ZINC | 0.789 | 210.4 Da LogP 4.66 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CCCCCC/C=C/CCCCCC=O
|
| ZINC13546064 ZINC | 0.700 | 210.4 Da LogP 4.66 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CCCC/C=C\CCCCCCCC=O
|
| ZINC1850393 ZINC | 0.700 | 210.4 Da LogP 4.66 TPSA 17.1 | ✓ Ro5 | ✓ Clean |
CCCC/C=C/CCCCCCCC=O
|
| ZINC57988531 ZINC | 0.600 | 360.3 Da LogP -6.60 TPSA 228.6 | 2 viol. | ✓ Clean |
O=C[C@H](O)[C@@H](O)[C@@H](O[C@@H](O)[C@H](O)[C…
|
| ZINC57988534 ZINC | 0.600 | 360.3 Da LogP -6.60 TPSA 228.6 | 2 viol. | ✓ Clean |
O=C[C@H](O)[C@@H](O)[C@H](O[C@@H](O)[C@H](O)[C@…
|
| ZINC12501123 ZINC | 0.595 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC4228234 ZINC | 0.595 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@@H](…
|
| ZINC79671662 ZINC | 0.595 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](COP(=O)(O)O)[C@H](O…
|
| ZINC3869683 ZINC | 0.587 | 278.4 Da LogP -1.08 TPSA 98.7 | ✓ Ro5 | ✓ Clean |
CC(C)(CO)[C@H](O)C(=O)NCCC(=O)NCCS
|
| ZINC3869684 ZINC | 0.587 | 278.4 Da LogP -1.08 TPSA 98.7 | ✓ Ro5 | ✓ Clean |
CC(C)(CO)[C@@H](O)C(=O)NCCC(=O)NCCS
|
| ZINC2382315554 ZINC | 0.556 | 311.3 Da LogP -5.37 TPSA 201.8 | 1 viol. | ✓ Clean |
N[C@@H](C=O)[C@@H](O)[C@H](O)[C@@H](O)C[C@H](O)…
|
| ZINC100055463 ZINC | 0.550 | 212.2 Da LogP -4.22 TPSA 141.6 | 1 viol. | ✓ Clean |
OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@H](O)CO
|
| ZINC100064885 ZINC | 0.550 | 212.2 Da LogP -4.22 TPSA 141.6 | 1 viol. | ✓ Clean |
OC[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO
|
| ZINC17780060 ZINC | 0.550 | 212.2 Da LogP -4.22 TPSA 141.6 | 1 viol. | ✓ Clean |
OC[C@@H](O)[C@H](O)C(O)[C@H](O)[C@H](O)CO
|
| ZINC17952732 ZINC | 0.550 | 212.2 Da LogP -4.22 TPSA 141.6 | 1 viol. | ✓ Clean |
OC[C@H](O)[C@@H](O)C(O)[C@H](O)[C@H](O)CO
|
| ZINC18042331 ZINC | 0.550 | 242.2 Da LogP -4.86 TPSA 161.8 | 1 viol. | ✓ Clean |
OC[C@H](O)[C@H](O)[C@H](O)[C@H](O)[C@H](O)[C@H]…
|
| ZINC18120313 ZINC | 0.550 | 212.2 Da LogP -4.22 TPSA 141.6 | 1 viol. | ✓ Clean |
OC[C@H](O)[C@H](O)C(O)[C@H](O)[C@H](O)CO
|
| ZINC3979006 ZINC | 0.550 | 212.2 Da LogP -4.22 TPSA 141.6 | 1 viol. | ✓ Clean |
OC[C@@H](O)[C@@H](O)C(O)[C@H](O)[C@H](O)CO
|
| ZINC4403103 ZINC | 0.550 | 242.2 Da LogP -4.86 TPSA 161.8 | 1 viol. | ✓ Clean |
OC[C@@H](O)[C@H](O)[C@H](O)[C@H](O)[C@H](O)[C@H…
|
| ZINC4403105 ZINC | 0.550 | 242.2 Da LogP -4.86 TPSA 161.8 | 1 viol. | ✓ Clean |
OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@H](O)[C@H…
|
| ZINC4403107 ZINC | 0.550 | 242.2 Da LogP -4.86 TPSA 161.8 | 1 viol. | ✓ Clean |
OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@H](O)[C@…
|
| ZINC9212412 ZINC | 0.550 | 212.2 Da LogP -4.22 TPSA 141.6 | 1 viol. | ✓ Clean |
OC[C@H](O)[C@@H](O)C(O)[C@H](O)[C@@H](O)CO
|
| ZINC12360002 ZINC | 0.549 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12360703 ZINC | 0.549 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC12503599 ZINC | 0.549 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC16546165 ZINC | 0.549 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@H](CO[P@](=O)(O)OP(=O)(…
|
| ZINC31977053 ZINC | 0.549 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC4806433 ZINC | 0.549 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@H](CO[P@@](=O)(O)OP(=O…
|
| ZINC53683898 ZINC | 0.549 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
| ZINC8586019 ZINC | 0.549 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@H]1O[C@@H](CO[P@](=O)(O)OP(=O)…
|
| ZINC8586022 ZINC | 0.549 | 427.2 Da LogP -1.75 TPSA 232.6 | 2 viol. | ✓ Clean |
Nc1ncnc2c1ncn2[C@@H]1O[C@@H](CO[P@@](=O)(O)OP(=…
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.