Protein profile

PA3500

hypothetical protein

Genome: NC_002516.2

Gene: PA3500 Structure source: AlphaFold UniProt Q9HYA9
Amino acids 339
Annotations 3
Features 15
PDB binders 16
Druggability 0.76

Overview

Basic information about this protein and its source genome.

Accession
PA3500
Gene
PA3500
Status
annotated
Amino acids
339
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.76
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MSTVDPVEQLLANGLKNLWYPICPVGFIEDKPVSLRRLGYKLAVWRDTDGTLHALEDHCPHRGAPLSRGVNLGDRLQCPYHGVEVRCDGVTARVPGSPGCKLEGSQATRFFHITEAAGAVWLYNSAGNVEEAPPLVLPEQLTDPEFSHFLCYTEWRGDYRYVLDNVMDPMHGTYLHKQSHSMSEGESQARFVTRDTDTGFIFEKDGQRGVNFDWTEWADTGMHWMRLEIPYPKTGGPGGNFHIVGSYTPIARDLCAVFHWRCRPLTGWQRDTWRFLYRNRLEARHWAVLEQDREMLEFMEPDANQRENLYQHDLGLVRLRRHLKNLAKAQLELIEARQL

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0051537 Binding to a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
  • GO:0046872 Binding to a metal ion.
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Sequence Features

Domain/signature hits from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
19 96 Pfam PF00355 Rieske [2Fe-2S] domain
19 96 InterPro IPR017941 Rieske [2Fe-2S] iron-sulphur domain
11 140 Gene3D G3DSA:2.102.10.10 -
11 140 InterPro IPR036922 Rieske [2Fe-2S] iron-sulphur domain superfamily
14 125 SUPERFAMILY SSF50022 ISP domain
14 125 InterPro IPR036922 Rieske [2Fe-2S] iron-sulphur domain superfamily
319 339 Coils Coil Coil
155 329 Pfam PF19112 Vanillate O-demethylase oxygenase C-terminal domain
155 329 InterPro IPR044043 Vanillate O-demethylase oxygenase-like, C-terminal catalytic domain
15 325 PANTHER PTHR21266 IRON-SULFUR DOMAIN CONTAINING PROTEIN
19 135 CDD cd03469 Rieske_RO_Alpha_N
143 336 Gene3D G3DSA:3.90.380.10 -
19 122 ProSiteProfiles PS51296 Rieske [2Fe-2S] iron-sulfur domain profile.
19 122 InterPro IPR017941 Rieske [2Fe-2S] iron-sulphur domain
134 329 SUPERFAMILY SSF55961 Bet v1-like

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3500
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.76
3 0.355
2 0.318

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

66 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
37T H9N289 180.2 Da LogP -1.04 TPSA 72.7 ✓ Ro5 ✓ Clean Cn1cnc2c1C(=O)NC(=O)N2C
9CA Q84II6 167.2 Da LogP 3.32 TPSA 15.8 ✓ Ro5 ✓ Clean c1ccc2c(c1)c3ccccc3[nH]2
9FL Q84II6 166.2 Da LogP 3.26 TPSA 0.0 ✓ Ro5 ✓ Clean c1ccc-2c(c1)Cc3c2cccc3
9G0 Q84II6 201.2 Da LogP 2.35 TPSA 66.5 ✓ Ro5 Alert c1ccc(c(c1)c2cccc(c2O)O)N
BPY Q84II6 186.2 Da LogP 2.76 TPSA 40.5 ✓ Ro5 Alert c1ccc(cc1)c2cccc(c2O)O
CFF H9N289 194.2 Da LogP -1.03 TPSA 61.8 ✓ Ro5 ✓ Clean Cn1cnc2c1C(=O)N(C(=O)N2C)C
D3M Q5S3I3 221.0 Da LogP 2.70 TPSA 46.5 ✓ Ro5 ✓ Clean COc1c(ccc(c1C(=O)O)Cl)Cl
EHX Q84II6 201.2 Da LogP 2.64 TPSA 41.5 ✓ Ro5 ✓ Clean c1ccc2c(c1)C3=CC=CC[C@@]3(N2)OO
FES C3RVP5 175.8 Da LogP 1.29 TPSA 0.0 ✓ Ro5 ✓ Clean S1[Fe]S[Fe]1
HXX Q5S3I3 207.0 Da LogP 2.40 TPSA 57.5 ✓ Ro5 ✓ Clean c1cc(c(c(c1Cl)C(=O)O)O)Cl
MXE Q84II6 76.1 Da LogP -0.37 TPSA 29.5 ✓ Ro5 ✓ Clean COCCO
OXY Q84II6 32.0 Da LogP 0.07 TPSA 34.1 ✓ Ro5 ✓ Clean O=O
PG0 Q84II6 120.1 Da LogP -0.36 TPSA 38.7 ✓ Ro5 ✓ Clean COCCOCCO
TEP H9N289 180.2 Da LogP -1.04 TPSA 72.7 ✓ Ro5 ✓ Clean CN1c2c([nH]cn2)C(=O)N(C1=O)C
U5A C3RVQ0 267.3 Da LogP -1.72 TPSA 139.4 1 viol. ✓ Clean [H]/N=C\1/N[C@H]2[C@@H](N/C(=N/[H])/N3[C@]2(N1)…
WBP Q84II6 202.2 Da LogP 2.47 TPSA 60.7 ✓ Ro5 Alert c1ccc(c(c1)c2cccc(c2O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.