Protein profile

PA3533

hypothetical protein

Genome: NC_002516.2

Gene: PA3533 Structure source: AlphaFold UniProt Q9HY77
Export view
Amino acids 108
Annotations 5
Features 15
PDB binders 2
Druggability 0.749

Overview

Basic information about this protein and its source genome.

Accession
PA3533
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA3533
Status
annotated
Amino acids
108
Structure source
AlphaFold
GO
GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. GO:0051537 Binding to a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands. GO:0015036 Catalysis of the reaction: substrate with reduced sulfide groups = substrate with oxidized disulfide bonds. GO:0046872 Binding to a metal ion. GO:0071236 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
40.217
Human E-value
6.07e-25
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.749
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MDIIETIKEQIANNPILLYMKGSPNAPQCGFSSRAAQVLMACGEKFAYVDILQNPEIRANLPKYANWPTFPQLWVNGELVGGSDILAEMFEKGELQTLVKDAAAKANA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Gene Ontology (GO)

5
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0051537 Binding to a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
  • GO:0015036 Catalysis of the reaction: substrate with reduced sulfide groups = substrate with oxidized disulfide bonds.
  • GO:0046872 Binding to a metal ion.
  • GO:0071236 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.

Sequence Features

Domain/signature hits from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
1 103 SUPERFAMILY SSF52833 Thioredoxin-like
1 103 InterPro IPR036249 Thioredoxin-like superfamily
3 105 PANTHER PTHR10293 GLUTAREDOXIN FAMILY MEMBER
3 105 InterPro IPR004480 Monothiol glutaredoxin-related
4 106 ProSiteProfiles PS51354 Glutaredoxin domain profile.
16 80 Pfam PF00462 Glutaredoxin
16 80 InterPro IPR002109 Glutaredoxin
1 107 PIRSF PIRSF005894 Monothiol_GRX
1 107 InterPro IPR014434 Monothiol glutaredoxin
7 96 CDD cd03028 GRX_PICOT_like
7 96 InterPro IPR033658 Glutaredoxin, PICOT-like
6 107 Gene3D G3DSA:3.40.30.10 Glutaredoxin
6 108 FunFam G3DSA:3.40.30.10:FF:000006 Glutaredoxin
4 100 NCBIfam TIGR00365 Grx4 family monothiol glutaredoxin
4 100 InterPro IPR004480 Monothiol glutaredoxin-related

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3533
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.749

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
FES
2WCI
P0AC69 175.8 Da LogP 1.29 TPSA 0.0 ✓ Ro5 ✓ Clean S1[Fe]S[Fe]1
GSH
5KQA
A0A1W6I4R7 307.3 Da LogP -2.21 TPSA 158.8 1 viol. ✓ Clean C(CC(=O)N[C@@H](CS)C(=O)NCC(=O)O)[C@@H](C(=O)O)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.