Protein profile

PA3550

alginate o-acetyltransferase AlgF

Genome: NC_002516.2

Gene: PA3550 algF Structure source: AlphaFold UniProt Q06062
Export view
Amino acids 216
Annotations 3
Features 9
PDB binders 0
Druggability 0.747

Overview

Basic information about this protein and its source genome.

Accession
PA3550
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA3550 algF
Status
annotated
Amino acids
216
Structure source
AlphaFold
GO
GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria). GO:0051979 The addition of O-acetyl ester groups to alginic acid, a linear polymer of D-mannuronate and L-guluronate. GO:0042121 The chemical reactions and pathways resulting in the formation of alginic acid, a hydrophilic polysaccharide occurring in, for example, the cell walls of brown algae (brown seaweeds).

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Periplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.747
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MNPMTRRHTWTRLACALSLGVAAFAAQADEGALYGPQAPKGSAFVRAYNAGNSELDVSVGSTSLNDVAPLGSSDFKFLPPGSYTAQVGQQSLPVKLDPDSYYTLVSQPGGKPQLVAEPPFKNKQKALVRVQNLSGSKLTLKTADGKTDVVKDVGPQSHGDREINPVKVNLALFDGSKKVSDLKPVTLARGEVVCLYVTGSGGKLAPVWVKRPVKAD

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
  • GO:0051979 The addition of O-acetyl ester groups to alginic acid, a linear polymer of D-mannuronate and L-guluronate.
  • GO:0042121 The chemical reactions and pathways resulting in the formation of alginic acid, a hydrophilic polysaccharide occurring in, for example, the cell walls of brown algae (brown seaweeds).

Sequence Features

Domain/signature hits from InterPro and related databases.

9 records
Show feature table
Start End DB Term Name
1 12 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
29 216 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
13 24 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 28 SignalP_EUK SignalP-noTM SignalP-noTM
1 28 Phobius SIGNAL_PEPTIDE Signal peptide region
16 194 Pfam PF11182 Alginate O-acetyl transferase AlgF
16 194 InterPro IPR035422 Alginate O-acetyl transferase AlgF
1 28 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
25 28 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3550
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.747
4 0.376