Protein profile

PA3567

oxidoreductase

Genome: NC_002516.2

Gene: PA3567 Structure source: AlphaFold UniProt Q9HY50
Amino acids 337
Annotations 4
Features 18
PDB binders 10
Druggability 0.725

Overview

Basic information about this protein and its source genome.

Accession
PA3567
Gene
PA3567
Status
annotated
Amino acids
337
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
41.892
Human E-value
1.83e-08
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.725
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MKAVGYYQSLPIDHPDALLDLELPEPTPGPRDLLVEVRAISVNPVDTKVRQRAQPEAGQAKVLGWDAAGVVRAVGSEVSLFRPGDRVWYAGDITRPGSNSELHRVDERIAGHLPKSLDFAQAAALPLTTITAWELLFERLQIAEGKADQGQSLLVVGAAGGVGSILVQLARQLTGLNVIGTASRAETQAWVRDLGAHHVIDHGKPLAEELKRIGVAEVSHVASLTHTDQHLEQIVAALRPQGRLALIDDPASLDIGKLKQKSLSLHWEFMYTRSMFQTDDMIEQHRLLERVAGLIDEGVLKTTVGEHFGRIDAANLRRAHALLESGRAKGKIVLEGF

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
  • GO:0003723 Binding to an RNA molecule or a portion thereof.
  • GO:0008270 Binding to a zinc ion (Zn).

Sequence Features

Domain/signature hits from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
150 171 ProSitePatterns PS01162 Quinone oxidoreductase / zeta-crystallin signature.
150 171 InterPro IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site
194 334 Pfam PF13602 Zinc-binding dehydrogenase
1 335 CDD cd08252 AL_MDR
1 335 InterPro IPR014182 Alcohol dehydrogenase, zinc-binding type 1
2 337 NCBIfam TIGR02817 zinc-binding alcohol dehydrogenase family protein
2 337 InterPro IPR014182 Alcohol dehydrogenase, zinc-binding type 1
117 287 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
117 287 InterPro IPR036291 NAD(P)-binding domain superfamily
25 334 Gene3D G3DSA:3.90.180.10 -
1 335 PANTHER PTHR44154 QUINONE OXIDOREDUCTASE
128 276 Gene3D G3DSA:3.40.50.720 -
31 89 Pfam PF08240 Alcohol dehydrogenase GroES-like domain
31 89 InterPro IPR013154 Alcohol dehydrogenase-like, N-terminal
16 334 SMART SM00829 PKS_ER_names_mod
16 334 InterPro IPR020843 Polyketide synthase, enoylreductase domain
9 137 SUPERFAMILY SSF50129 GroES-like
9 137 InterPro IPR011032 GroES-like superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3567
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.725

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

60 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
1XX O23939 128.1 Da LogP 0.76 TPSA 46.5 ✓ Ro5 ✓ Clean C[C@@H]1C(=O)C(=C(O1)C)O
2XX O23939 142.2 Da LogP 1.15 TPSA 46.5 ✓ Ro5 ✓ Clean CC[C@@H]1C(=O)C(=C(O1)C)O
3XX O23939 140.1 Da LogP 1.28 TPSA 46.5 ✓ Ro5 ✓ Clean C/C=C/1\C(=O)C(=C(O1)C)O
4XX O23939 114.1 Da LogP 0.38 TPSA 46.5 ✓ Ro5 ✓ Clean CC1=C(C(=O)CO1)O
8ID P00330 790.3 Da LogP -2.41 TPSA 318.3 3 viol. ✓ Clean c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO[P…
CO7 Q9Y7D0 835.6 Da LogP -0.76 TPSA 363.6 3 viol. ✓ Clean C/C=C/C(=O)SCCNC(=O)CCNC(=O)[C@@H](C(C)(C)CO[P@…
DIF Q8N4Q0 296.2 Da LogP 4.36 TPSA 49.3 ✓ Ro5 ✓ Clean c1ccc(c(c1)CC(=O)O)Nc2c(cccc2Cl)Cl
ETF P00330 100.0 Da LogP 0.54 TPSA 20.2 ✓ Ro5 ✓ Clean C(C(F)(F)F)O
KZH Q9SV68 292.4 Da LogP 4.84 TPSA 54.4 ✓ Ro5 ✓ Clean CCC=CCC(=O)C=CC=CCCCCCCCC(=O)O
X1H Q8N4Q0 376.4 Da LogP 5.22 TPSA 66.8 1 viol. ✓ Clean COc1ccc(cc1)C(=O)c2c3ccc(cc3sc2c4ccc(cc4)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.