Overview
Basic information about this protein and its source genome.
- Accession
- PA3600
- Gene
- PA3600 rpmJ2
- Status
- annotated
- Amino acids
- 50
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKVLASLKQAKLRHRDCQVVKRRGRLYVICKSNPRFKCVQGRPKPKIKRR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
4- GO:1990904 A macromolecular complex that contains both RNA and protein molecules.
- GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
- GO:0003735 The action of a molecule that contributes to the structural integrity of the ribosome.
- GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 14 | 40 | ProSitePatterns | PS00828 | Ribosomal protein L36 signature. |
| 14 | 40 | InterPro | IPR000473 | Ribosomal protein L36 |
| 1 | 45 | PANTHER | PTHR47781 | 50S RIBOSOMAL PROTEIN L36 2 |
| 1 | 45 | InterPro | IPR047621 | Ribosomal protein L36, bacteria |
| 1 | 41 | Hamap | MF_00251 | 50S ribosomal protein L36 [rpmJ]. |
| 1 | 41 | InterPro | IPR000473 | Ribosomal protein L36 |
| 1 | 41 | Pfam | PF00444 | Ribosomal protein L36 |
| 1 | 41 | NCBIfam | TIGR01022 | 50S ribosomal protein L36 |
| 1 | 41 | SUPERFAMILY | SSF57840 | Ribosomal protein L36 |
| 1 | 41 | InterPro | IPR035977 | Ribosomal protein L36 superfamily |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA3600
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.732 |