Overview
Basic information about this protein and its source genome.
- Accession
- PA3608
- Gene
- potB PA3608
- Status
- annotated
- Amino acids
- 297
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- CytoplasmicMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MRKNLGKWLLVWPPQAYLLFFFLVPALIMLFASFRFPGDYGGLAPWMYSEDGQTVYDLSVENYTRLTESWVYLQLFVKSFGYALVTTLACLLLAYPVATTLARAPAKWRNLLILLVILPFWSNLLVRVYAWMIILSPSGALTRGINAALDLFGAQPISLMFTPFAVILCMVYVHLPFMILPLYANLEKHDPALLDAAQDLGAGRWQRFWRVTFPLSLPGVAAGAALVFIPVLGMFAIPDLVGGTDGIMIGNLIKSQFLDSRDWPFGSALSIALTGCILLLVALGMGAARARKGGAHA
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
5- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0015417 Catalysis of the reaction: ATP + H2O + polyamine(out) = ADP + phosphate + polyamine(in).
- GO:1903711 The process in which spermidine is transported across a membrane.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
- GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 265 | 287 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 4 | 283 | SUPERFAMILY | SSF161098 | MetI-like |
| 4 | 283 | InterPro | IPR035906 | MetI-like superfamily |
| 153 | 175 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 79 | 278 | CDD | cd06261 | TM_PBP2 |
| 79 | 278 | InterPro | IPR000515 | ABC transporter type 1, transmembrane domain MetI-like |
| 289 | 297 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 9 | 31 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 96 | 286 | Pfam | PF00528 | Binding-protein-dependent transport system inner membrane component |
| 96 | 286 | InterPro | IPR000515 | ABC transporter type 1, transmembrane domain MetI-like |
| 111 | 133 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 176 | 214 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 238 | 264 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 37 | 79 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 215 | 237 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 79 | 98 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 16 | 36 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 7 | 289 | Gene3D | G3DSA:1.10.3720.10 | - |
| 7 | 289 | InterPro | IPR035906 | MetI-like superfamily |
| 76 | 284 | ProSiteProfiles | PS50928 | ABC transporter integral membrane type-1 domain profile. |
| 76 | 284 | InterPro | IPR000515 | ABC transporter type 1, transmembrane domain MetI-like |
| 2 | 293 | PANTHER | PTHR42929 | INNER MEMBRANE ABC TRANSPORTER PERMEASE PROTEIN YDCU-RELATED-RELATED |
| 135 | 153 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 265 | 288 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 80 | 98 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 110 | 134 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 15 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 99 | 109 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 215 | 237 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 154 | 175 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA3608
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.781 | ||||||
| 3 | 0.665 | ||||||
| 8 | 0.357 | ||||||
| 2 | 0.224 |