Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA3608
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: potB PA3608
Status: annotated
Amino acids: 297
Structure source: AlphaFold

GO

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0015417 Catalysis of the reaction: ATP + H2O + polyamine(out) = ADP + phosphate + polyamine(in). GO:1903711 The process in which spermidine is transported across a membrane. GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it. GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.781

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MRKNLGKWLLVWPPQAYLLFFFLVPALIMLFASFRFPGDYGGLAPWMYSEDGQTVYDLSVENYTRLTESWVYLQLFVKSFGYALVTTLACLLLAYPVATTLARAPAKWRNLLILLVILPFWSNLLVRVYAWMIILSPSGALTRGINAALDLFGAQPISLMFTPFAVILCMVYVHLPFMILPLYANLEKHDPALLDAAQDLGAGRWQRFWRVTFPLSLPGVAAGAALVFIPVLGMFAIPDLVGGTDGIMIGNLIKSQFLDSRDWPFGSALSIALTGCILLLVALGMGAARARKGGAHA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Gene Ontology (GO)

5

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
GO:0015417 Catalysis of the reaction: ATP + H2O + polyamine(out) = ADP + phosphate + polyamine(in).
GO:1903711 The process in which spermidine is transported across a membrane.
GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
GO:0055085 The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other.

Sequence Features

Domain/signature hits from InterPro and related databases.

30 records

Show feature table

Start	End	DB	Term	Name
265	287	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
4	283	SUPERFAMILY	SSF161098	MetI-like
4	283	InterPro	IPR035906	MetI-like superfamily
153	175	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
79	278	CDD	cd06261	TM_PBP2
79	278	InterPro	IPR000515	ABC transporter type 1, transmembrane domain MetI-like
289	297	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
9	31	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
96	286	Pfam	PF00528	Binding-protein-dependent transport system inner membrane component
96	286	InterPro	IPR000515	ABC transporter type 1, transmembrane domain MetI-like
111	133	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
176	214	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
238	264	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
37	79	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
215	237	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
79	98	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
16	36	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
7	289	Gene3D	G3DSA:1.10.3720.10	-
7	289	InterPro	IPR035906	MetI-like superfamily
76	284	ProSiteProfiles	PS50928	ABC transporter integral membrane type-1 domain profile.
76	284	InterPro	IPR000515	ABC transporter type 1, transmembrane domain MetI-like
2	293	PANTHER	PTHR42929	INNER MEMBRANE ABC TRANSPORTER PERMEASE PROTEIN YDCU-RELATED-RELATED
135	153	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
265	288	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
80	98	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
110	134	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
1	15	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
99	109	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
215	237	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
154	175	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA3608	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.781
3				0.665
8				0.357
2				0.224

PA3608