Protein profile
PA3610
polyamine ABC transporter substrate-binding protein PotD
Genome: NC_002516.2
Overview
Basic information about this protein and its source genome.
- Accession
- PA3610
- Gene
- potD PA3610
- Status
- annotated
- Amino acids
- 354
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Periplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MMKKLLLVATLMAGAAQATAAEKLYLFNWNDYIAEDTLKRFEQQCGCELVQEFYSGTEEMMAKLAAGASGYDVIIPTQNAVEALIRKGDLLELDKSRLANLSNEAAGYLDKDFDKGNRYSLPYAFTTTLVGYNKTELDKLGIDPADWSVIFDPAVLEKIKGRVTVMDDPQELFGAALKYLGHSANDTDPQHWKEAQALILAAKPYWAAFNSSSYIKELTLGNIWVAHGYSSDMYQARADAEAAGRAFKVDFALPRQGAVLAIDNMVIHKGSKNPDLAYRFIDFMLDGRNASELTNQIGTGTPNAAALPFIKPEIKTLAALFPDATTQARLEPLKDLNSRQRRALNKLWTEIKLR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
7- GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
- GO:0019810 Binding to putrescine, 1,4-diaminobutane, the polyamine formed by decarboxylation of ornithine and the metabolic precursor of spermidine and spermine.
- GO:0019809 Binding to spermidine, N-(3-aminopropyl)-1,4-diaminobutane.
- GO:0015847 The directed movement of putrescine into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Putrescine is 1,4-diaminobutane, the polyamine formed by decarboxylation of ornithine and the metabolic precursor of spermidine and spermine.
- GO:0015846 The directed movement of polyamines, organic compounds containing two or more amino groups, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
- GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
- GO:0019808 Binding to a polyamine, an organic compound containing two or more amino groups.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 22 | 352 | SUPERFAMILY | SSF53850 | Periplasmic binding protein-like II |
| 1 | 354 | PIRSF | PIRSF019574 | Periplasmic_polyamine_BP |
| 1 | 354 | InterPro | IPR001188 | Spermidine/putrescine-binding periplasmic protein |
| 16 | 20 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
| 1 | 20 | SignalP_GRAM_NEGATIVE | SignalP-noTM | SignalP-noTM |
| 5 | 15 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 24 | 348 | CDD | cd13590 | PBP2_PotD_PotF_like |
| 126 | 349 | Gene3D | G3DSA:3.40.190.10 | - |
| 24 | 321 | Gene3D | G3DSA:3.40.190.10 | - |
| 1 | 4 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 21 | 354 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 38 | 319 | Pfam | PF13416 | Bacterial extracellular solute-binding protein |
| 38 | 319 | InterPro | IPR006059 | Bacterial extracellular solute-binding protein |
| 1 | 21 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 299 | 325 | PRINTS | PR00909 | Bacterial periplasmic spermidine/putrescine-binding protein signature |
| 299 | 325 | InterPro | IPR001188 | Spermidine/putrescine-binding periplasmic protein |
| 254 | 273 | PRINTS | PR00909 | Bacterial periplasmic spermidine/putrescine-binding protein signature |
| 254 | 273 | InterPro | IPR001188 | Spermidine/putrescine-binding periplasmic protein |
| 86 | 99 | PRINTS | PR00909 | Bacterial periplasmic spermidine/putrescine-binding protein signature |
| 86 | 99 | InterPro | IPR001188 | Spermidine/putrescine-binding periplasmic protein |
| 27 | 43 | PRINTS | PR00909 | Bacterial periplasmic spermidine/putrescine-binding protein signature |
| 27 | 43 | InterPro | IPR001188 | Spermidine/putrescine-binding periplasmic protein |
| 43 | 64 | PRINTS | PR00909 | Bacterial periplasmic spermidine/putrescine-binding protein signature |
| 43 | 64 | InterPro | IPR001188 | Spermidine/putrescine-binding periplasmic protein |
| 117 | 133 | PRINTS | PR00909 | Bacterial periplasmic spermidine/putrescine-binding protein signature |
| 117 | 133 | InterPro | IPR001188 | Spermidine/putrescine-binding periplasmic protein |
| 145 | 159 | PRINTS | PR00909 | Bacterial periplasmic spermidine/putrescine-binding protein signature |
| 145 | 159 | InterPro | IPR001188 | Spermidine/putrescine-binding periplasmic protein |
| 167 | 186 | PRINTS | PR00909 | Bacterial periplasmic spermidine/putrescine-binding protein signature |
| 167 | 186 | InterPro | IPR001188 | Spermidine/putrescine-binding periplasmic protein |
| 70 | 84 | PRINTS | PR00909 | Bacterial periplasmic spermidine/putrescine-binding protein signature |
| 70 | 84 | InterPro | IPR001188 | Spermidine/putrescine-binding periplasmic protein |
| 204 | 223 | PRINTS | PR00909 | Bacterial periplasmic spermidine/putrescine-binding protein signature |
| 204 | 223 | InterPro | IPR001188 | Spermidine/putrescine-binding periplasmic protein |
| 1 | 20 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 7 | 351 | PANTHER | PTHR30222 | SPERMIDINE/PUTRESCINE-BINDING PERIPLASMIC PROTEIN |
| 1 | 20 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA3610
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.746 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| AG2 | P31133 | 130.2 Da LogP -0.79 TPSA 87.9 | ✓ Ro5 | ✓ Clean |
C(CCNC(=N)N)CN
|
|
| JFN | P31133 | 89.1 Da LogP -0.02 TPSA 35.2 | ✓ Ro5 | ✓ Clean |
C[C@H](COC)N
|
|
| MLI | P31133 | 102.0 Da LogP -3.12 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(=O)[O-]
|
|
| N2P | P31133 | 102.2 Da LogP 0.07 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
C(CCN)CCN
|
|
| ONT | P31133 | 133.2 Da LogP -0.00 TPSA 44.5 | ✓ Ro5 | ✓ Clean |
C[C@@H](COCCOC)N
|
|
| ONW | P31133 | 191.3 Da LogP 0.40 TPSA 53.7 | ✓ Ro5 | ✓ Clean |
C[C@H](CO[C@H](C)COCCOC)N
|
|
| P33 | P31133 | 326.4 Da LogP -0.93 TPSA 95.8 | ✓ Ro5 | ✓ Clean |
C(COCCOCCOCCOCCOCCOCCO)O
|
|
| PUT | P31133 | 88.2 Da LogP -0.32 TPSA 52.0 | ✓ Ro5 | ✓ Clean |
C(CCN)CN
|
|
| SPD | P0AFK9 | 145.2 Da LogP -0.34 TPSA 64.1 | ✓ Ro5 | ✓ Clean |
C(CCNCCCN)CN
|
|
| SPM | P31133 | 202.3 Da LogP -0.36 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
C(CCNCCCN)CNCCCN
|
|
| TAM | P31133 | 163.2 Da LogP -1.17 TPSA 86.7 | ✓ Ro5 | ✓ Clean |
C(CO)C(CCO)(CCO)N
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC12501520 | 1.000 | 458.5 Da LogP -0.88 TPSA 123.5 | 1 viol. | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC3874716 | 1.000 | 414.5 Da LogP -0.90 TPSA 114.3 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC4283769 | 1.000 | 238.3 Da LogP -0.96 TPSA 77.4 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCO
|
| ZINC4521548 | 1.000 | 282.3 Da LogP -0.95 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCO
|
| ZINC5178829 | 1.000 | 326.4 Da LogP -0.93 TPSA 95.8 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5178830 | 1.000 | 370.4 Da LogP -0.91 TPSA 105.1 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC27564039 | 0.933 | 202.3 Da LogP -0.36 TPSA 76.1 | ✓ Ro5 | ✓ Clean |
NCCCCNCCCNCCCN
|
| ZINC13545924 | 0.737 | 214.3 Da LogP -0.10 TPSA 123.8 | 1 viol. | ✓ Clean |
N=C(N)NCCCCCCCNC(=N)N
|
| ZINC1561855 | 0.737 | 200.3 Da LogP -0.49 TPSA 123.8 | 1 viol. | ✓ Clean |
N=C(N)NCCCCCCNC(=N)N
|
| ZINC2013578 | 0.737 | 228.3 Da LogP 0.29 TPSA 123.8 | 1 viol. | ✓ Clean |
N=C(N)NCCCCCCCCNC(=N)N
|
| ZINC3995661 | 0.737 | 256.4 Da LogP 1.07 TPSA 123.8 | 1 viol. | ✓ Clean |
N=C(N)NCCCCCCCCCCNC(=N)N
|
| ZINC115086873 | 0.688 | 209.2 Da LogP -1.08 TPSA 83.2 | ✓ Ro5 | ✓ Clean |
NOCCOCCOCCOCCO
|
| ZINC137432264 | 0.688 | 457.6 Da LogP -0.91 TPSA 129.3 | 1 viol. | ✓ Clean |
NCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC146143823 | 0.688 | 237.3 Da LogP -1.00 TPSA 83.2 | ✓ Ro5 | ✓ Clean |
NCCOCCOCCOCCOCCO
|
| ZINC1542984442 | 0.688 | 413.5 Da LogP -0.93 TPSA 120.1 | ✓ Ro5 | ✓ Clean |
NCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC1565503710 | 0.688 | 254.3 Da LogP -0.03 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCS
|
| ZINC1580161 | 0.688 | 208.3 Da LogP -0.33 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCO
|
| ZINC16052118 | 0.688 | 340.4 Da LogP -0.28 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCO
|
| ZINC16052257 | 0.688 | 384.5 Da LogP -0.26 TPSA 94.1 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC1857792028 | 0.688 | 430.6 Da LogP 0.04 TPSA 94.1 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCS
|
| ZINC1857792057 | 0.688 | 474.6 Da LogP 0.06 TPSA 103.3 | 1 viol. | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCOCCOCCS
|
| ZINC230494776 | 0.688 | 325.4 Da LogP -0.96 TPSA 101.6 | ✓ Ro5 | ✓ Clean |
NCCOCCOCCOCCOCCOCCOCCO
|
| ZINC34317654 | 0.688 | 472.6 Da LogP -0.23 TPSA 112.5 | 1 viol. | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC38917157 | 0.688 | 210.3 Da LogP -0.04 TPSA 47.9 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCS
|
| ZINC44076059 | 0.688 | 428.5 Da LogP -0.24 TPSA 103.3 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC5210101 | 0.688 | 252.3 Da LogP -0.31 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCO
|
| ZINC5650743 | 0.688 | 222.3 Da LogP 0.07 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
CCOCCOCCOCCOCCO
|
| ZINC5997860 | 0.688 | 296.4 Da LogP -0.29 TPSA 75.6 | ✓ Ro5 | ✓ Clean |
COCCOCCOCCOCCOCCOCCO
|
| ZINC6403917 | 0.688 | 354.4 Da LogP 0.11 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
CCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC77271182 | 0.688 | 281.3 Da LogP -0.98 TPSA 92.4 | ✓ Ro5 | ✓ Clean |
NCCOCCOCCOCCOCCOCCO
|
| ZINC83253921 | 0.688 | 369.5 Da LogP -0.95 TPSA 110.9 | ✓ Ro5 | ✓ Clean |
NCCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC90741446 | 0.688 | 386.5 Da LogP 0.02 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCOCCOCCS
|
| ZINC90741447 | 0.688 | 298.4 Da LogP -0.01 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCCOCCS
|
| ZINC144169243 | 0.647 | 281.3 Da LogP -1.37 TPSA 89.4 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCNCCOCCOCCO
|
| ZINC205758716 | 0.647 | 457.6 Da LogP -1.31 TPSA 126.3 | 1 viol. | ✓ Clean |
OCCOCCOCCOCCOCCNCCOCCOCCOCCOCCO
|
| ZINC575441396 | 0.647 | 369.5 Da LogP -1.34 TPSA 107.9 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCNCCOCCOCCOCCO
|
| ZINC2575038 | 0.625 | 205.3 Da LogP 0.00 TPSA 86.7 | ✓ Ro5 | ✓ Clean |
NC(CCCO)(CCCO)CCCO
|
| ZINC1644613 | 0.611 | 206.3 Da LogP 0.83 TPSA 47.9 | ✓ Ro5 | ✓ Clean |
CCCCOCCOCCOCCO
|
| ZINC258839852 | 0.611 | 276.3 Da LogP 0.61 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
OCCOCCOCCOCCOCC(F)(F)F
|
| ZINC167715346 | 0.600 | 266.3 Da LogP -0.18 TPSA 77.4 | ✓ Ro5 | ✓ Clean |
OCCCOCCOCCOCCOCCCO
|
| ZINC34160867 | 0.600 | 222.3 Da LogP -0.20 TPSA 68.2 | ✓ Ro5 | ✓ Clean |
OCCCOCCOCCOCCCO
|
| ZINC1580159 | 0.588 | 210.3 Da LogP -0.26 TPSA 58.9 | ✓ Ro5 | ✓ Clean |
OCCOCCSCCOCCO
|
| ZINC1666747 | 0.583 | 227.4 Da LogP 3.39 TPSA 61.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCCCCNC(=N)N
|
| ZINC1542984432 | 0.579 | 398.4 Da LogP -0.43 TPSA 122.1 | ✓ Ro5 | ✓ Clean |
O=C(O)CCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC207588231 | 0.579 | 207.3 Da LogP -0.75 TPSA 60.0 | ✓ Ro5 | ✓ Clean |
CNCCOCCOCCOCCO
|
| ZINC258836919 | 0.579 | 364.4 Da LogP -0.27 TPSA 84.8 | ✓ Ro5 | ✓ Clean |
C#CCOCCOCCOCCOCCOCCOCCOCCO
|
| ZINC33967025 | 0.579 | 252.3 Da LogP -0.87 TPSA 94.5 | ✓ Ro5 | ✓ Clean |
O=C(O)COCCOCCOCCOCCO
|
| ZINC575408819 | 0.579 | 383.5 Da LogP -1.00 TPSA 99.1 | ✓ Ro5 | ✓ Clean |
CN(CCOCCOCCOCCO)CCOCCOCCOCCO
|
| ZINC79016673 | 0.579 | 232.3 Da LogP -0.32 TPSA 57.2 | ✓ Ro5 | ✓ Clean |
C#CCOCCOCCOCCOCCO
|
| ZINC96503366 | 0.579 | 408.5 Da LogP -0.26 TPSA 94.1 | ✓ Ro5 | ✓ Clean |
C#CCOCCOCCOCCOCCOCCOCCOCCOCCO
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.