Overview
Basic information about this protein and its source genome.
- Accession
- PA3623
- Gene
- PA3623
- Status
- annotated
- Amino acids
- 297
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- OuterMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MDKGEGLRLAATLRQWTRLYGGCHLLLGAVVCSLLAACSSSPPGGVKVVDRNGSAPAAARRTPVTSGQYIVRRGDTLYSIAFRFGWDWKALAARNGIAPPYTIQVGQAIQFGGRASTQPSVAKNTPVVAAPVATKPTPVPPAVSTSVPAKPAPAPASTTTPPSSGATPVVAGPAVGGWAWPASGTLIGRFASNGSLNKGIDIAGQLGQPVLAASGGTVVYAGSGLRGYGELVIIKHNETYVSAYGHNRRLLVREGQQVKVGQSIAEMGSTGTDRVKLHFEIRRQGKPVDPLQYLPRR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
4- GO:0032153 The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles.
- GO:0009279 A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0004222 Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 141 | 158 | MobiDBLite | mobidb-lite | consensus disorder prediction |
| 141 | 168 | MobiDBLite | mobidb-lite | consensus disorder prediction |
| 69 | 109 | Pfam | PF01476 | LysM domain |
| 69 | 109 | InterPro | IPR018392 | LysM domain |
| 68 | 294 | SUPERFAMILY | SSF51261 | Duplicated hybrid motif |
| 68 | 294 | InterPro | IPR011055 | Duplicated hybrid motif |
| 99 | 294 | PANTHER | PTHR21666 | PEPTIDASE-RELATED |
| 67 | 107 | FunFam | G3DSA:3.10.350.10:FF:000006 | YgeR family lipoprotein |
| 1 | 40 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 67 | 111 | ProSiteProfiles | PS51782 | LysM domain profile. |
| 67 | 111 | InterPro | IPR018392 | LysM domain |
| 197 | 281 | CDD | cd12797 | M23_peptidase |
| 197 | 290 | Pfam | PF01551 | Peptidase family M23 |
| 197 | 290 | InterPro | IPR016047 | Peptidase M23 |
| 69 | 110 | CDD | cd00118 | LysM |
| 69 | 110 | InterPro | IPR018392 | LysM domain |
| 68 | 110 | Gene3D | G3DSA:3.10.350.10 | LysM domain |
| 68 | 110 | InterPro | IPR036779 | LysM domain superfamily |
| 68 | 112 | SMART | SM00257 | LysM_2 |
| 68 | 112 | InterPro | IPR018392 | LysM domain |
| 148 | 295 | FunFam | G3DSA:2.70.70.10:FF:000010 | M23 family peptidase |
| 152 | 295 | Gene3D | G3DSA:2.70.70.10 | Glucose Permease (Domain IIA) |
| 152 | 295 | InterPro | IPR011055 | Duplicated hybrid motif |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA3623
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.633 | ||||||
| 3 | 0.349 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
No PDB structure with a co-crystallized ligand found for this exact protein.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| 4SQ | O33599 | 281.2 Da LogP -2.12 TPSA 158.8 | ✓ Ro5 | ✓ Clean |
C(CP(=O)(CNC(=O)CN)O)C(=O)NCC(=O)O
|
|
| CAC | O33599 | 137.0 Da LogP -0.52 TPSA 40.1 | ✓ Ro5 | ✓ Clean |
C[As](=O)(C)[O-]
|
|
| TLA | O33599 | 150.1 Da LogP -2.12 TPSA 115.1 | ✓ Ro5 | ✓ Clean |
[C@@H]([C@H](C(=O)O)O)(C(=O)O)O
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC12359024 | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC13533920 | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC1532740 | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC1549593 | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC2013424 | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@H](O)C(=O)O
|
| ZINC3581021 | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC3860635 | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC5783661 | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(=O)O
|
| ZINC6072527 | 0.692 | 210.1 Da LogP -3.40 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)[C@@H](O)[C@@H](O)[C@@H](O)[C@@H](O)C(=O)O
|
| ZINC1560405156 | 0.588 | 208.1 Da LogP -1.79 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)/C(O)=C(\O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC1560405157 | 0.588 | 208.1 Da LogP -1.79 TPSA 155.5 | 1 viol. | ✓ Clean |
O=C(O)/C(O)=C(/O)[C@H](O)[C@H](O)C(=O)O
|
| ZINC2561009 | 0.571 | 203.2 Da LogP -2.35 TPSA 121.5 | ✓ Ro5 | ✓ Clean |
NCC(=O)NCCC(=O)NCC(=O)O
|
| ZINC1569725 | 0.545 | 246.2 Da LogP -3.62 TPSA 150.6 | ✓ Ro5 | ✓ Clean |
NCC(=O)NCC(=O)NCC(=O)NCC(=O)O
|
| ZINC4545903 | 0.545 | 360.3 Da LogP -5.39 TPSA 208.8 | 1 viol. | ✓ Clean |
NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)O
|
| ZINC4545906 | 0.545 | 303.3 Da LogP -4.51 TPSA 179.7 | 1 viol. | ✓ Clean |
NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)O
|
| ZINC1529331 | 0.500 | 206.1 Da LogP -2.21 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
O=C(O)C(=O)[C@H](C(=O)O)[C@@H](O)C(=O)O
|
| ZINC1529332 | 0.500 | 206.1 Da LogP -2.21 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
O=C(O)C(=O)[C@H](C(=O)O)[C@H](O)C(=O)O
|
| ZINC1529333 | 0.500 | 206.1 Da LogP -2.21 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
O=C(O)C(=O)[C@@H](C(=O)O)[C@@H](O)C(=O)O
|
| ZINC1529334 | 0.500 | 206.1 Da LogP -2.21 TPSA 149.2 | ✓ Ro5 | ✓ Clean |
O=C(O)C(=O)[C@@H](C(=O)O)[C@H](O)C(=O)O
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.