Protein profile

PA3625

5'-nucleotidase SurE

Genome: NC_002516.2

Gene: PA3625 surE Structure source: AlphaFold UniProt Q9HY05
Amino acids 249
Annotations 9
Features 13
PDB binders 4
Druggability 0.743

Overview

Basic information about this protein and its source genome.

Accession
PA3625
Gene
PA3625 surE
Status
annotated
Amino acids
249
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.743
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MRILIANDDGVTAPGIAALYDALADHADCVVIAPDQDKSGASSSLTLDRPLHPQRLDNGFISLNGTPTDCVHLGLNGLLEELPDMVVSGINLGANLGDDVLYSGTVAAAIEGRFLKGPAFAFSLVSRLTDNLPTAMHFARLLVSAHERLAVPPRTVLNVNIPNLPLDRVRGIQLTRLGHRARAAAPVKVVNPRGKEGYWIAAAGDAEDGGPGTDFHAVMQGYVSITPLQLDRTFHEAFGGLDEWLGGLT

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 8 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

8
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0008254 Catalysis of the reaction: a 3'-ribonucleotide + H2O = a ribonucleoside + phosphate.
  • GO:0008253 Catalysis of the reaction: a 5'-ribonucleotide + H2O = a ribonucleoside + phosphate.
  • GO:0004309 Catalysis of the reaction: polyphosphate(n) + H2O = polyphosphate(n-1) + phosphate.
  • GO:0046872 Binding to a metal ion.
  • GO:0000166 Binding to a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
  • GO:0016787 Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc.
  • GO:0008252 Catalysis of the reaction: a nucleotide + H2O = a nucleoside + phosphate.

Sequence Features

Domain/signature hits from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
1 248 Hamap MF_00060 5'/3'-nucleotidase SurE [surE].
1 248 InterPro IPR030048 Survival protein SurE
1 248 Gene3D G3DSA:3.40.1210.10 -
1 248 InterPro IPR036523 SurE-like phosphatase/nucleotidase superfamily
2 235 PANTHER PTHR30457 5'-NUCLEOTIDASE SURE
2 235 InterPro IPR030048 Survival protein SurE
3 181 Pfam PF01975 Survival protein SurE
3 181 InterPro IPR002828 Survival protein SurE-like phosphatase/nucleotidase
1 246 SUPERFAMILY SSF64167 SurE-like
1 246 InterPro IPR036523 SurE-like phosphatase/nucleotidase superfamily
1 232 NCBIfam TIGR00087 5'/3'-nucleotidase SurE
1 232 InterPro IPR002828 Survival protein SurE-like phosphatase/nucleotidase
1 249 FunFam G3DSA:3.40.1210.10:FF:000001 5'/3'-nucleotidase SurE

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3625
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.743

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

54 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
ADE P66881 135.1 Da LogP -0.06 TPSA 80.5 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)c(ncn2)N
ADN P66881 267.2 Da LogP -1.98 TPSA 139.5 ✓ Ro5 ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
VO4 P96112 114.9 Da LogP -3.69 TPSA 86.2 ✓ Ro5 ✓ Clean [O-][V](=O)([O-])[O-]
WO4 P96112 247.8 Da LogP -2.62 TPSA 80.3 ✓ Ro5 ✓ Clean [O-][W](=O)(=O)[O-]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.