Protein profile

PA3733a

hypothetical protein

Genome: NC_002516.2

Gene: YP_008719769.1 Structure source: ColabFold
Export view
Amino acids 118
Annotations 0
Features 7
PDB binders 0
Druggability 0.596

Overview

Basic information about this protein and its source genome.

Accession
PA3733a
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
YP_008719769.1
Status
annotated
Amino acids
118
Structure source
ColabFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.596
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MHRRTLFAFFRSLTSLIRRNRRPDLDSLKQRLADAFAPHPFTLSQPRPDGGRVVTLVDPQGETLLQRVIAKVQLNDESYLEDAVQTIRRELQVLVGRMEEDVLATFRERDHVLLYSSR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

7 records
Show feature table
Start End DB Term Name
1 19 Phobius SIGNAL_PEPTIDE Signal peptide region
6 14 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
20 118 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
15 19 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 5 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
29 112 Pfam PF12021 Protein of unknown function (DUF3509)
29 112 InterPro IPR021898 Protein of unknown function DUF3509

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
ColabFold PA3733A
ColabFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.596
1 0.301