Protein profile

PA3766

aromatic amino acid transporter

Genome: NC_002516.2

Gene: PA3766 Structure source: AlphaFold UniProt Q9HXM9
Export view
Amino acids 418
Annotations 2
Features 39
PDB binders 0
Druggability 0.703

Overview

Basic information about this protein and its source genome.

Accession
PA3766
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA3766
Status
annotated
Amino acids
418
Structure source
AlphaFold
GO
GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0003333 The process in which an amino acid is transported across a membrane.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.703
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MSDTRVQQYQDHAGAEAVDSSGLEVKRLTFLEAVAMIVGTNIGAGVLSMAYASRKAGFMPLLLWLAVAGLFTTISMLYVSETALRTRTHNQLSGLAQRYVGSFGAWAIFLSVAVNSIGALIAYMSGSGKILSAFFGISPALGSVLFFIPAAGVLYLGLSAIGKGEKFISIGMVSMILILVAATLLNDNTEFARLLDGDWIYMVPVFNIAVFCFSAQYIVPEMARGFSHAPERLPKAVITGMLTTFVLLSIVPLSVIALTGLENQSEVATLAWGKALGEWAFFTANTFALCAMLTSYWGLGGSFLTNIFDKFHKLGPENRPKTRLLVLAIVALPPFVLAYSGLVGFVNALYFAGAFSGVILSIMPILMLRSARRNGDFEPAWKCGWIAHPAIQAVIVTIYLASAAYAICSAMNLLPAGW

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0003333 The process in which an amino acid is transported across a membrane.

Sequence Features

Domain/signature hits from InterPro and related databases.

39 records
Show feature table
Start End DB Term Name
281 303 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
100 122 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
385 407 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
17 412 PANTHER PTHR32195 OS07G0662800 PROTEIN
324 342 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 29 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
53 57 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
29 382 Pfam PF03222 Tryptophan/tyrosine permease family
29 382 InterPro IPR018227 Amino acid/polyamine transporter 2
125 129 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
324 346 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
137 159 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
343 347 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
200 219 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
80 98 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
99 124 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
57 79 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
305 323 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
166 185 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
188 198 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
239 261 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
348 368 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
260 278 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
58 79 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
130 155 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
240 259 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
199 219 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
279 304 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
156 166 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
369 388 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
167 187 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
30 52 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
389 414 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
10 418 PIRSF PIRSF006060 AA_transporter
23 416 Gene3D G3DSA:1.20.1740.10 Amino acid/polyamine transporter I
30 52 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
220 239 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
350 372 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
415 418 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3766
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
3 0.703
7 0.401
5 0.252