Overview
Basic information about this protein and its source genome.
- Accession
- PA3771
- Gene
- PA3771
- Status
- annotated
- Amino acids
- 325
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKGSTDPHSSSAALLAAFGAAVLDINRLARDKTLERFHRTALERLQQLVPFQRAWWGRAALIDGVPVEHSAHLFNLEEHYVEDWKSISHDDITVGLVHARPGTAVAVDMQATAGLRWLGARHDIGELLCVIHVDPITRLSDHVALYRTPGGPPFADQEKLLLGQLSAHLAAAVSANQIRTLVALRESLERQALAMAVCDRYGVLHCAERGFVDLLLGAWPGWTGPQLPEETSPQGYRDARLVIDSRQVGDLYLLTARQPSAIEQLSNREGDVALLFSEGKTYKQIARDLGLAPNTVRHHIRTIYSKLGVNDKASIAHLLHQFPPG
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
4- GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
- GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
- GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
- GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 30 | 325 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 249 | 321 | Gene3D | G3DSA:1.10.10.10 | - |
| 249 | 321 | InterPro | IPR036388 | Winged helix-like DNA-binding domain superfamily |
| 264 | 318 | Pfam | PF00196 | Bacterial regulatory proteins, luxR family |
| 264 | 318 | InterPro | IPR000792 | Transcription regulator LuxR, C-terminal |
| 44 | 315 | PANTHER | PTHR44688 | - |
| 279 | 295 | PRINTS | PR00038 | LuxR bacterial regulatory protein HTH signature |
| 279 | 295 | InterPro | IPR000792 | Transcription regulator LuxR, C-terminal |
| 295 | 307 | PRINTS | PR00038 | LuxR bacterial regulatory protein HTH signature |
| 295 | 307 | InterPro | IPR000792 | Transcription regulator LuxR, C-terminal |
| 265 | 279 | PRINTS | PR00038 | LuxR bacterial regulatory protein HTH signature |
| 265 | 279 | InterPro | IPR000792 | Transcription regulator LuxR, C-terminal |
| 258 | 323 | ProSiteProfiles | PS50043 | LuxR-type HTH domain profile. |
| 258 | 323 | InterPro | IPR000792 | Transcription regulator LuxR, C-terminal |
| 12 | 29 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 265 | 321 | CDD | cd06170 | LuxR_C_like |
| 265 | 321 | InterPro | IPR000792 | Transcription regulator LuxR, C-terminal |
| 251 | 321 | SUPERFAMILY | SSF46894 | C-terminal effector domain of the bipartite response regulators |
| 251 | 321 | InterPro | IPR016032 | Signal transduction response regulator, C-terminal effector |
| 262 | 319 | SMART | SM00421 | luxrmega5 |
| 262 | 319 | InterPro | IPR000792 | Transcription regulator LuxR, C-terminal |
| 1 | 11 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA3771
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.665 | ||||||
| 9 | 0.575 |