Protein profile

PA3771

transcriptional regulator

Genome: NC_002516.2

Gene: PA3771 Structure source: AlphaFold UniProt Q9HXM4
Export view
Amino acids 325
Annotations 4
Features 22
PDB binders 0
Druggability 0.665

Overview

Basic information about this protein and its source genome.

Accession
PA3771
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA3771
Status
annotated
Amino acids
325
Structure source
AlphaFold
GO
GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons. GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon. GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription. GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.665
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MKGSTDPHSSSAALLAAFGAAVLDINRLARDKTLERFHRTALERLQQLVPFQRAWWGRAALIDGVPVEHSAHLFNLEEHYVEDWKSISHDDITVGLVHARPGTAVAVDMQATAGLRWLGARHDIGELLCVIHVDPITRLSDHVALYRTPGGPPFADQEKLLLGQLSAHLAAAVSANQIRTLVALRESLERQALAMAVCDRYGVLHCAERGFVDLLLGAWPGWTGPQLPEETSPQGYRDARLVIDSRQVGDLYLLTARQPSAIEQLSNREGDVALLFSEGKTYKQIARDLGLAPNTVRHHIRTIYSKLGVNDKASIAHLLHQFPPG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

Sequence Features

Domain/signature hits from InterPro and related databases.

22 records
Show feature table
Start End DB Term Name
30 325 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
249 321 Gene3D G3DSA:1.10.10.10 -
249 321 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
264 318 Pfam PF00196 Bacterial regulatory proteins, luxR family
264 318 InterPro IPR000792 Transcription regulator LuxR, C-terminal
44 315 PANTHER PTHR44688 -
279 295 PRINTS PR00038 LuxR bacterial regulatory protein HTH signature
279 295 InterPro IPR000792 Transcription regulator LuxR, C-terminal
295 307 PRINTS PR00038 LuxR bacterial regulatory protein HTH signature
295 307 InterPro IPR000792 Transcription regulator LuxR, C-terminal
265 279 PRINTS PR00038 LuxR bacterial regulatory protein HTH signature
265 279 InterPro IPR000792 Transcription regulator LuxR, C-terminal
258 323 ProSiteProfiles PS50043 LuxR-type HTH domain profile.
258 323 InterPro IPR000792 Transcription regulator LuxR, C-terminal
12 29 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
265 321 CDD cd06170 LuxR_C_like
265 321 InterPro IPR000792 Transcription regulator LuxR, C-terminal
251 321 SUPERFAMILY SSF46894 C-terminal effector domain of the bipartite response regulators
251 321 InterPro IPR016032 Signal transduction response regulator, C-terminal effector
262 319 SMART SM00421 luxrmega5
262 319 InterPro IPR000792 Transcription regulator LuxR, C-terminal
1 11 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3771
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.665
9 0.575