Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA3840
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: rlmF PA3840
Status: annotated
Amino acids: 336
Structure source: AlphaFold

EC

2.1.1.181

GO

GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. GO:0052907 Catalysis of the reaction: S-adenosyl-L-methionine + adenine(1618) in 23S rRNA = S-adenosyl-L-homocysteine + rRNA containing N(6)-methyladenine(1618) in 23S rRNA. GO:0070475 The addition of a methyl group to an atom in the nucleoside base portion of a nucleotide residue in an rRNA molecule. GO:0008168 Catalysis of the transfer of a methyl group to an acceptor molecule. GO:0006364 Any process involved in the conversion of a primary ribosomal RNA (rRNA) transcript into one or more mature rRNA molecules. GO:0008988 Catalysis of the reaction: adenosine in rRNA + S-adenosyl-L-methionine = H+ + N(6)-methyladenosine in rRNA + S-adenosyl-L-homocysteine.

Target profile

Computed evidence for target prioritization.

Human off-target: hit
Human identity (%): 35.87
Human E-value: 1.37e-10
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.707

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MPRPTSPHPDAERKSASPLHPRNRHLGRYDFPRLIAGSPELERFVILNPYGRQSIDFADPAAVKAFNRALLQQFYDVREWDIPDGYLCPPIPGRADYLHYLADLLGASHDGLIPRGPGLRALDVGTGANCIYPLLGHHEYGWRFVGADIDPQSLASAAAILAANPRFAAAIELRRQPDRRQIFQGLIGVDERFDMTLCNPPFHASLDEATRGSRRKWKNLGKLDPTRTLPLLNFGGQGAELYCEGGEAAFLAGMAEESRAFATQVFWFTTLVSKASNLPNLQERLKTLGASDIRVVDMAQGQKQSRFVAWTYLDKKQRRAWRKERWTAALLEPLGE

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Enzyme Commission (EC)

1

2.1.1.181

Gene Ontology (GO)

6

GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
GO:0052907 Catalysis of the reaction: S-adenosyl-L-methionine + adenine(1618) in 23S rRNA = S-adenosyl-L-homocysteine + rRNA containing N(6)-methyladenine(1618) in 23S rRNA.
GO:0070475 The addition of a methyl group to an atom in the nucleoside base portion of a nucleotide residue in an rRNA molecule.
GO:0008168 Catalysis of the transfer of a methyl group to an acceptor molecule.
GO:0006364 Any process involved in the conversion of a primary ribosomal RNA (rRNA) transcript into one or more mature rRNA molecules.
GO:0008988 Catalysis of the reaction: adenosine in rRNA + S-adenosyl-L-methionine = H+ + N(6)-methyladenosine in rRNA + S-adenosyl-L-homocysteine.

Sequence Features

Domain/signature hits from InterPro and related databases.

15 records

Show feature table

Start	End	DB	Term	Name
6	326	PIRSF	PIRSF029038	Mtase_YbiN
6	326	InterPro	IPR016909	Ribosomal RNA large subunit methyltransferase F
16	316	Hamap	MF_01848	Ribosomal RNA large subunit methyltransferase F [rlmF].
16	316	InterPro	IPR016909	Ribosomal RNA large subunit methyltransferase F
14	314	Pfam	PF05971	RNA methyltransferase
14	314	InterPro	IPR010286	METTL16/RlmF family
50	314	Gene3D	G3DSA:3.40.50.150	Vaccinia Virus protein VP39
50	314	InterPro	IPR029063	S-adenosyl-L-methionine-dependent methyltransferase superfamily
49	314	FunFam	G3DSA:3.40.50.150:FF:000045	Ribosomal RNA large subunit methyltransferase F
120	223	CDD	cd02440	AdoMet_MTases
19	319	PANTHER	PTHR13393	SAM-DEPENDENT METHYLTRANSFERASE
19	319	InterPro	IPR010286	METTL16/RlmF family
54	313	SUPERFAMILY	SSF53335	S-adenosyl-L-methionine-dependent methyltransferases
54	313	InterPro	IPR029063	S-adenosyl-L-methionine-dependent methyltransferase superfamily
1	22	MobiDBLite	mobidb-lite	consensus disorder prediction

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA3840	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
2				0.707
1				0.61

PA3840