Protein profile

PA3883

short-chain dehydrogenase

Genome: NC_002516.2

Gene: PA3883 Structure source: AlphaFold UniProt Q9HXC9
Amino acids 276
Annotations 1
Features 28
PDB binders 10
Druggability 0.691

Overview

Basic information about this protein and its source genome.

Accession
PA3883
Gene
PA3883
Status
annotated
Amino acids
276
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
42.727
Human E-value
7.42e-11
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.691
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MSQPVAFVTGCSSGIGRALADAFQRAGYRVWASARKEDDVRALAEAGFQAVQLDVNDAAALARLAEELGVEAAGLDVLVNNAGYGAMGPLLDGGVEAMRRQFETNVFAVVGVTRALFPLLRRKSGLVVNVGSVSGVLVTPFAGAYCASKAAVHALSDALRLELAPFGVEVLEVQPGAIASNFGASASREMDSVVDERSPWWPLRRQIQARAAASQDNPTSAEDFARQLLAAVQRRPRPPLVRIGNGSRALPALARWLPRGLLERLLKKRFGLDTRL

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

1
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Sequence Features

Domain/signature hits from InterPro and related databases.

28 records
Show feature table
Start End DB Term Name
16 20 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
4 254 Gene3D G3DSA:3.40.50.720 -
2 273 PANTHER PTHR44169 NADPH-DEPENDENT 1-ACYLDIHYDROXYACETONE PHOSPHATE REDUCTASE
132 160 ProSitePatterns PS00061 Short-chain dehydrogenases/reductases family signature.
132 160 InterPro IPR020904 Short-chain dehydrogenase/reductase, conserved site
5 15 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
119 135 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
119 135 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
145 164 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
145 164 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
166 183 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
166 183 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
5 22 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
5 22 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
73 84 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
73 84 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
4 236 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
4 236 InterPro IPR036291 NAD(P)-binding domain superfamily
21 276 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
5 244 CDD cd05374 17beta-HSD-like_SDR_c
125 133 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
125 133 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
145 164 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
73 84 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
1 4 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
5 188 Pfam PF00106 short chain dehydrogenase
5 188 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
1 20 Phobius SIGNAL_PEPTIDE Signal peptide region

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA3883
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.691
3 0.281

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

160 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
5SD P14061 288.4 Da LogP 4.17 TPSA 34.1 ✓ Ro5 ✓ Clean C[C@]12CCC(=O)C[C@@H]1CC[C@@H]3[C@@H]2CC[C@]4([…
AND P14061 288.4 Da LogP 3.88 TPSA 37.3 ✓ Ro5 ✓ Clean C[C@]12CC[C@H]3[C@H]([C@@H]1CCC2=O)CC=C4[C@@]3(…
AOM P14061 292.5 Da LogP 3.75 TPSA 40.5 ✓ Ro5 ✓ Clean C[C@]12CC[C@@H](C[C@@H]1CC[C@@H]3[C@@H]2CC[C@]4…
ASD P14061 286.4 Da LogP 4.09 TPSA 34.1 ✓ Ro5 ✓ Clean C[C@]12CCC(=O)C=C1CC[C@@H]3[C@@H]2CC[C@]4([C@H]…
DHT P14061 290.4 Da LogP 3.96 TPSA 37.3 ✓ Ro5 ✓ Clean C[C@]12CCC(=O)C[C@@H]1CC[C@@H]3[C@@H]2CC[C@]4([…
EM9 P14061 560.3 Da LogP 8.21 TPSA 60.8 2 viol. ✓ Clean CCCCN(C)C(=O)CCCCCCCCCC[C@@H]1Cc2cc(ccc2[C@@H]3…
EQI P14061 268.4 Da LogP 3.74 TPSA 37.3 ✓ Ro5 ✓ Clean C[C@]12CC[C@@H]3c4ccc(cc4CC=C3[C@@H]1CCC2=O)O
EST P14061 272.4 Da LogP 3.61 TPSA 40.5 ✓ Ro5 ✓ Clean C[C@]12CC[C@@H]3c4ccc(cc4CC[C@H]3[C@@H]1CC[C@@H…
F0A P14061 435.6 Da LogP 4.19 TPSA 92.8 ✓ Ro5 ✓ Clean C[C@]12CC[C@@H]3c4cc(c(cc4CC[C@H]3[C@@H]1C[C@@H…
TES P14061 288.4 Da LogP 3.88 TPSA 37.3 ✓ Ro5 ✓ Clean C[C@]12CC[C@H]3[C@H]([C@@H]1CC[C@@H]2O)CCC4=CC(…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.