Overview
Basic information about this protein and its source genome.
- Accession
- PA3902
- Gene
- ivy PA3902
- Status
- annotated
- Amino acids
- 153
- Structure source
- Experimental + AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Periplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MNGVSRLLSLALLGAALHWAPAQAEEQPRLFELLGQPGYKATWHAMFKGESDVPKWVSDASGPSSPSTSLSLEGQPYVLANSCKPHDCGNNRLLVAFRGDKSAAYGLQVSLPDEPAEVMQTPSKYATYRWYGEPSRQVRELLMKQLESDPNWK
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
- GO:0043086 Any process that stops or reduces the activity of an enzyme.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 24 | SignalP_EUK | SignalP-noTM | SignalP-noTM |
| 25 | 153 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 24 | 153 | Gene3D | G3DSA:3.40.1420.10 | Inhibitor of vertebrate lysozyme |
| 24 | 153 | InterPro | IPR036501 | Inhibitor of vertebrate lysozyme superfamily |
| 1 | 153 | PIRSF | PIRSF009103 | Ivy |
| 1 | 153 | InterPro | IPR014453 | Inhibitor of vertebrate lysozyme |
| 1 | 24 | Phobius | SIGNAL_PEPTIDE | Signal peptide region |
| 36 | 151 | Pfam | PF08816 | Inhibitor of vertebrate lysozyme (Ivy) |
| 1 | 24 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM |
| 1 | 6 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. |
| 25 | 153 | SUPERFAMILY | SSF89872 | Inhibitor of vertebrate lysozyme, Ivy |
| 25 | 153 | InterPro | IPR036501 | Inhibitor of vertebrate lysozyme superfamily |
| 7 | 17 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. |
| 18 | 24 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
2 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.688 |
Pockets (P2RANK)
Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).
| P2RANK | Sticks | Spheres | Surfaces | Score | Probability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|---|
| 1 | 3.22 | 0.111 |
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.718 |