Overview
Basic information about this protein and its source genome.
- Accession
- PA3912
- Gene
- ubiV PA3912
- Status
- annotated
- Amino acids
- 296
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MKLSLGPLLFYWDKRQIFDFYAEMAGQPLDVIYLGETVCAKRRALSLNDWQALARELAQATRAELVLSGLALIEAASELSSLRRLCENGELRVEANDMAAVYYLSQRGVPFVGGPALNLYNGHALAELYSWGMRRWIPPVEVSGKLLRGVLDQAAQLGLEQLQTEVFAYGHLPLAYSARCFTARAENRPKDDCQFCCQQYPEGIPLLSQEGEALFTLNGIQTMSGKVSNLLADYRSLEHSGADLLRLSPRAQGMAEVIAAFDRVRKGAAPPLAVEGCNGYWHGRPGMLRAEEAGLC
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
3- GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
- GO:0046872 Binding to a metal ion.
- GO:0006744 The chemical reactions and pathways resulting in the formation of ubiquinone, a lipid-soluble electron-transporting coenzyme.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 290 | Hamap | MF_02233 | Ubiquinone biosynthesis protein UbiV [ubiV]. |
| 1 | 290 | InterPro | IPR043693 | Ubiquinone biosynthesis protein UbiV |
| 1 | 274 | PANTHER | PTHR30217 | PEPTIDASE U32 FAMILY |
| 86 | 262 | Pfam | PF01136 | Peptidase family U32 |
| 86 | 262 | InterPro | IPR001539 | Peptidase U32 |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA3912
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.674 | ||||||
| 2 | 0.341 | ||||||
| 9 | 0.339 |