Protein profile

PA3912

hypothetical protein

Genome: NC_002516.2

Gene: ubiV PA3912 Structure source: AlphaFold UniProt Q9HXA1

Export view

Amino acids 296

Annotations 3

Features 5

PDB binders 0

Druggability 0.674

Overview

Basic information about this protein and its source genome.

Accession: PA3912
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: ubiV PA3912
Status: annotated
Amino acids: 296
Structure source: AlphaFold

GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. GO:0046872 Binding to a metal ion. GO:0006744 The chemical reactions and pathways resulting in the formation of ubiquinone, a lipid-soluble electron-transporting coenzyme.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.674

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MKLSLGPLLFYWDKRQIFDFYAEMAGQPLDVIYLGETVCAKRRALSLNDWQALARELAQATRAELVLSGLALIEAASELSSLRRLCENGELRVEANDMAAVYYLSQRGVPFVGGPALNLYNGHALAELYSWGMRRWIPPVEVSGKLLRGVLDQAAQLGLEQLQTEVFAYGHLPLAYSARCFTARAENRPKDDCQFCCQQYPEGIPLLSQEGEALFTLNGIQTMSGKVSNLLADYRSLEHSGADLLRLSPRAQGMAEVIAAFDRVRKGAAPPLAVEGCNGYWHGRPGMLRAEEAGLC

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
GO:0046872 Binding to a metal ion.
GO:0006744 The chemical reactions and pathways resulting in the formation of ubiquinone, a lipid-soluble electron-transporting coenzyme.

Sequence Features

Domain/signature hits from InterPro and related databases.

5 records

Show feature table

Start	End	DB	Term	Name
1	290	Hamap	MF_02233	Ubiquinone biosynthesis protein UbiV [ubiV].
1	290	InterPro	IPR043693	Ubiquinone biosynthesis protein UbiV
1	274	PANTHER	PTHR30217	PEPTIDASE U32 FAMILY
86	262	Pfam	PF01136	Peptidase family U32
86	262	InterPro	IPR001539	Peptidase U32

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA3912	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.674
2				0.341
9				0.339