Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA3913
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: ubiU PA3913
Status: annotated
Amino acids: 331
Structure source: AlphaFold

GO

GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. GO:0046872 Binding to a metal ion. GO:0008233 Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid. GO:0006508 The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds. GO:0006744 The chemical reactions and pathways resulting in the formation of ubiquinone, a lipid-soluble electron-transporting coenzyme.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.702

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MQLVCPAGSLPALKSALRQGADAIYVGFRDDTNARHFAGLNLDERQLQEGLRRVHEAGRQLYVAVNTYSSAQGWERWQRAVDQAADLGVDALIAADVAVLGYAAKRHPRLNLHLSVQGSATNAAALALYHERYGIRRAVLPRVLSLAQVRQVAAGSPVPVEVFAFGSLCIMAEGRCHLSSYVTGESPNLCGVCSPARAVRWSEEPEGLTSRLNEVLIDRYAAGEAAGYPTLCKGRFLVNGQRFHALEEPTSLNTLDLVPQLAEIGVAAVKIEGRQRSPAYVEQVTRVWRQALDSYASAPGAYSVQPQWQRALAGLSEGHQTTLGAYHRSWQ

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Gene Ontology (GO)

5

GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
GO:0046872 Binding to a metal ion.
GO:0008233 Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
GO:0006508 The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
GO:0006744 The chemical reactions and pathways resulting in the formation of ubiquinone, a lipid-soluble electron-transporting coenzyme.

Sequence Features

Domain/signature hits from InterPro and related databases.

7 records

Show feature table

Start	End	DB	Term	Name
161	179	ProSitePatterns	PS01276	Peptidase family U32 signature.
161	179	InterPro	IPR001539	Peptidase U32
75	330	Pfam	PF01136	Peptidase family U32
75	330	InterPro	IPR001539	Peptidase U32
1	331	Hamap	MF_02232	Ubiquinone biosynthesis protein UbiU [ubiU].
1	331	InterPro	IPR043692	Ubiquinone biosynthesis protein UbiU
1	330	PANTHER	PTHR30217	PEPTIDASE U32 FAMILY

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA3913	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
6				0.702
1				0.672

PA3913