Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA4045
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA4045
Status: annotated
Amino acids: 265
Structure source: AlphaFold

GO

GO:1990191 Protein complex facilitating ATP-dependent cobalamin (vitamin B12) transport through inner cell membrane (periplasm to cytoplasm) in Gram-negative bacteria. In E. coli the system is composed of a periplasmic cobalamin-binding protein (BtuF), an integral membrane homodimer, BtuC, and a cytoplasmic ATP-binding homodimer BtuD. GO:0015889 The directed movement of cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Periplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.689

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MRSFWLLACLLLSLSAGAAQRVVSLAPSLTDSVLELGAARRLVGVLDGGERPAAIGDLPSVGRYGQVNLERLLELQPDLILVWPGSVPEAQLQRLRDFGIALFIAEPHSLDELALQLAALGEALGEAEAGQRLSARFREGMRRLAERYRRDKPLKVFYQVWDRPLYTIGGRQVISDALRVCGAENLFGDLPQPAPQVSVEAVLARDPAVIVAGSHAQLELWRQWPALAATRRGQLYRIEDKNLERPSFAMLAATEKLCRSLAGAR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2

GO:1990191 Protein complex facilitating ATP-dependent cobalamin (vitamin B12) transport through inner cell membrane (periplasm to cytoplasm) in Gram-negative bacteria. In E. coli the system is composed of a periplasmic cobalamin-binding protein (BtuF), an integral membrane homodimer, BtuC, and a cytoplasmic ATP-binding homodimer BtuD.
GO:0015889 The directed movement of cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.

Sequence Features

Domain/signature hits from InterPro and related databases.

18 records

Show feature table

Start	End	DB	Term	Name
4	14	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
1	19	SignalP_EUK	SignalP-noTM	SignalP-noTM
13	136	Gene3D	G3DSA:3.40.50.1980	Nitrogenase molybdenum iron protein domain
1	19	Phobius	SIGNAL_PEPTIDE	Signal peptide region
19	261	SUPERFAMILY	SSF53807	Helical backbone metal receptor
141	264	Gene3D	G3DSA:3.40.50.1980	Nitrogenase molybdenum iron protein domain
20	265	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1	3	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
21	211	NCBIfam	NF038402	helical backbone metal receptor
1	18	SignalP_GRAM_NEGATIVE	SignalP-noTM	SignalP-noTM
21	265	ProSiteProfiles	PS50983	Iron siderophore/cobalamin periplasmic-binding domain profile.
21	265	InterPro	IPR002491	ABC transporter periplasmic binding domain
1	21	SignalP_GRAM_POSITIVE	SignalP-TM	SignalP-TM
22	218	Pfam	PF01497	Periplasmic binding protein
22	218	InterPro	IPR002491	ABC transporter periplasmic binding domain
16	61	PANTHER	PTHR42860	VITAMIN B12-BINDING PROTEIN
15	19	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
20	259	CDD	cd01144	BtuF

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA4045	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
2				0.689

PA4045