Protein target profile

PA4089

3-ketoacyl-ACP reductase

Genome: NC_002516.2

Gene: PA4089 3D evidence: AlphaFold DB model UniProt Q9HWT9
Length 253
Pocket druggability 0.694
Ligand records 58
EC / GO 0 / 1
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

3 signals
How to read this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal TPW pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Overview

Basic information about this protein and its source genome.

Accession
PA4089
Gene
PA4089
Status
annotated
Amino acids
253
3D evidence
AlphaFold DB model

Target profile

Computed evidence for target prioritization.

Human off-target
Hit
Human identity (%)
41.935
Human E-value
6.59e-10
Gut microbiome off-target
Hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected pocket evidence

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.694
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MRRLENRVALVTGAGQGIGRAIAECFAAEGARVLLATRTASRGQAVLEAIRLGGGTAELLAVDLSEYDAARRAVSATLERFGQLDILLHNAAAFPQCALAELDEGTLERTLAVNLKSCFRLTQAALPALRRSVAGRVLVTSSVTGPRTAIPGLSHYAASKAGVNGFIRAAALELAGDGITVNGVEPGLVATPALGSLGDAAALAAHIPLGRVGQPLDIAHAMLFLASDEASYITGQTLVVDGGALLPENGGLA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

1
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Sequence Features

Domain/signature hits from InterPro and related databases.

30 records
Show feature table
Start End DB Term Name
1 27 Phobius SIGNAL_PEPTIDE Signal peptide region
1 7 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
82 93 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
82 93 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
135 143 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
135 143 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
156 175 PRINTS PR00080 Short-chain dehydrogenase/reductase (SDR) superfamily signature
156 175 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
7 187 SMART SM00822 This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group.
5 245 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
5 245 InterPro IPR036291 NAD(P)-binding domain superfamily
13 243 Pfam PF13561 Enoyl-(Acyl carrier protein) reductase
28 253 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
2 245 PANTHER PTHR43639 OXIDOREDUCTASE, SHORT-CHAIN DEHYDROGENASE/REDUCTASE FAMILY (AFU_ORTHOLOGUE AFUA_5G02870)
1 248 FunFam G3DSA:3.40.50.720:FF:000084 Short-chain dehydrogenase reductase
129 145 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
129 145 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
156 175 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
82 93 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
8 25 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
8 25 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
208 228 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
208 228 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
177 194 PRINTS PR00081 Glucose/ribitol dehydrogenase family signature
177 194 InterPro IPR002347 Short-chain dehydrogenase/reductase SDR
143 171 ProSitePatterns PS00061 Short-chain dehydrogenases/reductases family signature.
143 171 InterPro IPR020904 Short-chain dehydrogenase/reductase, conserved site
1 246 Gene3D G3DSA:3.40.50.720 -
20 27 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
8 19 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB PA4089
AlphaFold DB full sequence Viewing
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #3
0.694
Show in viewer
Site 2 FPocket #1
0.664
Show in viewer
Site 3 FPocket #2
0.361
Show in viewer

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records
Chemistry signal

Structural and bioactivity evidence are both available for this target.

Direct evidence 0 58 via homologs
Structural ligands 3 0 loaded crystals
Bioactive compounds 5 50 ZINC proposed compounds
Drug-like & clean 32 26 PAINS alerts
Best available ligand signal
F3V PDB via homolog 73.1 Da · LogP -0.47 · TPSA 43.1 Open detail RCSB PDB
Detail RCSB PDB F3V PDB via homolog
Detail RCSB PDB MLH PDB via homolog
Detail RCSB PDB PG5 PDB via homolog
Detail ChEMBL KDH ChEMBL via homolog · pchembl 6.50

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
F3V RCSB PDB A0QP46 73.1 Da LogP -0.47 TPSA 43.1 ✓ Ro5 ✓ Clean CC(=O)CN
MLH RCSB PDB V5VHN7 417.3 Da LogP 4.34 TPSA 54.7 ✓ Ro5 ✓ Clean CCOC(=O)c1c2cc(c(cc2n(c1CN(C)C)c3ccccc3)Br)O
PG5 RCSB PDB B1MJ88 178.2 Da LogP 0.31 TPSA 36.9 ✓ Ro5 ✓ Clean COCCOCCOCCOC

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.