Protein profile

PA4097

alcohol dehydrogenase

Genome: NC_002516.2

Gene: PA4097 Structure source: AlphaFold UniProt Q9HWT1
Amino acids 352
Annotations 3
Features 19
PDB binders 7
Druggability 0.691

Overview

Basic information about this protein and its source genome.

Accession
PA4097
Gene
PA4097
Status
annotated
Amino acids
352
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
36.782
Human E-value
3.39e-08
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.691
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MKALRWHAARDLRLSELERQAPRPGEVELEVAYCGICGSDLHEYQSGPHSIPQAEAHPLSGCRAPLTLGHEFCGVVAALGPGVEGPRIGDRVAVEPEYRCGECRYCREGRYNLCESMGFIGLMGDGGFAERARVPAYMLHRLPDAVGFRQAAVLEPAAVALHALRRSSLAPGQRCAVFGLGPIGLLLVMLARLRGIEDIAAVDVSPERLALAGEFGASRALDARDGDTAARLREGGALDCAFEAAGSQASLDAALASLRKGGELVLVSLMGEVRLDAFDLVNRELRLLGSVGYRDAYPELIALLADGRLDLARAVTRSVPLEQAVEHGFEALLRDKSQLKVLVNPNPALADA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0008868 Catalysis of the reaction: galactitol-1-phosphate + NAD+ = D-tagatose 6-phosphate + NADH + H+.
  • GO:0008270 Binding to a zinc ion (Zn).
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records
Show feature table
Start End DB Term Name
175 193 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 343 CDD cd08233 butanediol_DH_like
69 83 ProSitePatterns PS00059 Zinc-containing alcohol dehydrogenases signature.
69 83 InterPro IPR002328 Alcohol dehydrogenase, zinc-type, conserved site
194 352 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
7 343 SMART SM00829 PKS_ER_names_mod
7 343 InterPro IPR020843 Polyketide synthase, enoylreductase domain
1 174 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
24 140 Pfam PF08240 Alcohol dehydrogenase GroES-like domain
24 140 InterPro IPR013154 Alcohol dehydrogenase-like, N-terminal
3 346 PANTHER PTHR43161 SORBITOL DEHYDROGENASE
1 179 SUPERFAMILY SSF50129 GroES-like
1 179 InterPro IPR011032 GroES-like superfamily
10 330 Gene3D G3DSA:3.90.180.10 -
182 305 Pfam PF00107 Zinc-binding dehydrogenase
182 305 InterPro IPR013149 Alcohol dehydrogenase-like, C-terminal
147 310 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
147 310 InterPro IPR036291 NAD(P)-binding domain superfamily
159 291 Gene3D G3DSA:3.40.50.720 -

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4097
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.691

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

76 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
572 Q00796 301.4 Da LogP -1.10 TPSA 89.9 ✓ Ro5 ✓ Clean CN(C)S(=O)(=O)N1CCN(CC1)c2ccnc(n2)CO
BMD P42328 87.1 Da LogP 0.27 TPSA 43.1 ✓ Ro5 ✓ Clean CCCC(=O)N
BO3 O96496 61.8 Da LogP -2.05 TPSA 60.7 ✓ Ro5 ✓ Clean B(O)(O)O
ETF P42328 100.0 Da LogP 0.54 TPSA 20.2 ✓ Ro5 ✓ Clean C(C(F)(F)F)O
FU2 Q46UZ9 96.1 Da LogP 1.09 TPSA 30.2 ✓ Ro5 ✓ Clean c1cc(oc1)C=O
FXY P00326 157.3 Da LogP 2.09 TPSA 29.1 ✓ Ro5 ✓ Clean CCCCCC[C@@H](C)NC=O
ISP Q46UZ9 140.1 Da LogP 0.50 TPSA 66.8 ✓ Ro5 ✓ Clean CC(C)OP(=O)(O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.