Protein profile

PA4145

transcriptional regulator

Genome: NC_002516.2

Gene: PA4145 Structure source: AlphaFold UniProt Q9HWN6
Amino acids 296
Annotations 3
Features 14
PDB binders 3
Druggability 0.736

Overview

Basic information about this protein and its source genome.

Accession
PA4145
Gene
PA4145
Status
annotated
Amino acids
296
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.736
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MIDDIRYLIVFAKIAETGSVSGGAEALGLSAATASLHLSRLERNLGRALLYRNSRKLSLTQDGTQLLDTARSMLELYEKGFIEFRQRAVSTRNSLRISMPAVFVNGDFTRHLAAFIEEHPDLDLGIACDDSRHDIIGDGIDIAFRIGDLPDSSLKARHLFLLPRQVVAAPAFLARHAPLEHPRDLQRLEWIGLGMRPDSRLFRHARDDEEVRVDYTPRVRVDSVEASCRLARLGVGLAAPPTYLSDEPIRRGELRAVLPEWRLEPLKVYAVWPPNVPASSIAYTLINRLYEAFNPG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0000976 Binding to a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Sequence Features

Domain/signature hits from InterPro and related databases.

14 records
Show feature table
Start End DB Term Name
3 89 Gene3D G3DSA:1.10.10.10 -
3 89 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
6 63 Pfam PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
6 63 InterPro IPR000847 Transcription regulator HTH, LysR
90 291 Gene3D G3DSA:3.40.190.290 -
95 275 CDD cd08422 PBP2_CrgA_like
8 280 PANTHER PTHR30537 HTH-TYPE TRANSCRIPTIONAL REGULATOR
3 108 SUPERFAMILY SSF46785 Winged helix DNA-binding domain
3 108 InterPro IPR036390 Winged helix DNA-binding domain superfamily
3 60 ProSiteProfiles PS50931 LysR-type HTH domain profile.
3 60 InterPro IPR000847 Transcription regulator HTH, LysR
92 292 Pfam PF03466 LysR substrate binding domain
92 292 InterPro IPR005119 LysR, substrate-binding
92 294 SUPERFAMILY SSF53850 Periplasmic binding protein-like II

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4145
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.736
6 0.612
8 0.278
2 0.211

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

11 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
1PS Q8NP91 201.2 Da LogP -0.09 TPSA 61.1 ✓ Ro5 ✓ Clean c1cc[n+](cc1)CCCS(=O)(=O)[O-]
FOR Q8NP91 30.0 Da LogP -0.18 TPSA 17.1 ✓ Ro5 ✓ Clean C=O
PEO Q8NP91 34.0 Da LogP 0.02 TPSA 40.5 ✓ Ro5 ✓ Clean OO

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.