Protein profile

PA4153

2,3-butanediol dehydrogenase

Genome: NC_002516.2

Gene: PA4153 Structure source: AlphaFold UniProt Q9HWM8
Amino acids 363
Annotations 3
Features 18
PDB binders 6
Druggability 0.702

Overview

Basic information about this protein and its source genome.

Accession
PA4153
Gene
PA4153
Status
annotated
Amino acids
363
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
38.222
Human E-value
1.87e-39
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.702
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MNSSPQANAAMRAAVWHGRHDIRVEDVPLPAEPPPGWVQIRVHWCGICGSDLHEYLAGPVFIPVEAPHPLTGLKDQCILGHEFSGEIVRLGNGVTGFAVGQAVAADACQHCGTCYYCRHGLYNICENLAFTGLMNNGAFAEYVNVPANLLYALPAGFPSEAGALIEPLAVGMHAVKKAGSLLGQNVVVVGAGTIGLSTIMCARAAGAAQVIALEMSSARKAKALEVGASQVLDPSRCDALGEIRALTGGLGADVSFECIGNKHTAKLAIDAIRKAGKCVLVGIFEEPSEFNFFELVSTEKQLLGALAYNGEFADVIAFIADGRLDIAPLVTGRIGLEEIVERGFEELVNNKEHNVKIIVSPGG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0008868 Catalysis of the reaction: galactitol-1-phosphate + NAD+ = D-tagatose 6-phosphate + NADH + H+.
  • GO:0008270 Binding to a zinc ion (Zn).
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Sequence Features

Domain/signature hits from InterPro and related databases.

18 records
Show feature table
Start End DB Term Name
35 151 InterPro IPR013154 Alcohol dehydrogenase-like, N-terminal
11 28 Pfam PF13823 Alcohol dehydrogenase GroES-associated
11 28 InterPro IPR027399 Alcohol dehydrogenase GroES-associated
159 315 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
159 315 InterPro IPR036291 NAD(P)-binding domain superfamily
80 94 ProSitePatterns PS00059 Zinc-containing alcohol dehydrogenases signature.
80 94 InterPro IPR002328 Alcohol dehydrogenase, zinc-type, conserved site
194 320 Pfam PF00107 Zinc-binding dehydrogenase
194 320 InterPro IPR013149 Alcohol dehydrogenase-like, C-terminal
11 360 CDD cd08233 butanediol_DH_like
18 359 SMART SM00829 PKS_ER_names_mod
18 359 InterPro IPR020843 Polyketide synthase, enoylreductase domain
170 306 Gene3D G3DSA:3.40.50.720 -
20 341 Gene3D G3DSA:3.90.180.10 -
35 151 Pfam PF08240 Alcohol dehydrogenase GroES-like domain
9 192 SUPERFAMILY SSF50129 GroES-like
9 192 InterPro IPR011032 GroES-like superfamily
12 360 PANTHER PTHR43161 SORBITOL DEHYDROGENASE

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4153
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.702
7 0.207

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

74 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
572 Q00796 301.4 Da LogP -1.10 TPSA 89.9 ✓ Ro5 ✓ Clean CN(C)S(=O)(=O)N1CCN(CC1)c2ccnc(n2)CO
BMD P42328 87.1 Da LogP 0.27 TPSA 43.1 ✓ Ro5 ✓ Clean CCCC(=O)N
BO3 O96496 61.8 Da LogP -2.05 TPSA 60.7 ✓ Ro5 ✓ Clean B(O)(O)O
CHD P00328 408.6 Da LogP 3.45 TPSA 98.0 ✓ Ro5 ✓ Clean C[C@H](CCC(=O)O)[C@H]1CC[C@@H]2[C@@]1([C@H](C[C…
ETF P42328 100.0 Da LogP 0.54 TPSA 20.2 ✓ Ro5 ✓ Clean C(C(F)(F)F)O
ETX P39462 90.1 Da LogP 0.02 TPSA 29.5 ✓ Ro5 ✓ Clean CCOCCO

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.