Overview
Basic information about this protein and its source genome.
- Accession
- PA4177
- Gene
- PA4177
- Status
- annotated
- Amino acids
- 133
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSQTFHGSCLCGALHYRLSSPPRALSHCHCGQCRKAHGAAFASYGSVPVADLHIDHGADLLAAFRSSPAVLRRFCSRCGSPLFWSRSEGEFADWVSVALGSLDTPFPAAKQKHVQVASMACWCRIADDWPRFD
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0016846 Catalysis of the elimination of hydrogen sulfide or substituted H2S.
- GO:0046872 Binding to a metal ion.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 5 | 123 | ProSiteProfiles | PS51891 | CENP-V/GFA domain profile. |
| 5 | 123 | InterPro | IPR006913 | CENP-V/GFA domain |
| 5 | 132 | PANTHER | PTHR33337 | GFA DOMAIN-CONTAINING PROTEIN |
| 1 | 127 | Gene3D | G3DSA:3.90.1590.10 | - |
| 1 | 132 | SUPERFAMILY | SSF51316 | Mss4-like |
| 1 | 132 | InterPro | IPR011057 | Mss4-like superfamily |
| 27 | 116 | Pfam | PF04828 | Glutathione-dependent formaldehyde-activating enzyme |
| 27 | 116 | InterPro | IPR006913 | CENP-V/GFA domain |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA4177
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.68 | ||||||
| 4 | 0.675 | ||||||
| 1 | 0.462 |