Protein target profile

PA4185

transcriptional regulator

Genome: NC_002516.2

Gene: PA4185 3D evidence: AlphaFold DB model UniProt Q9HWJ6
Length 242
Pocket druggability 0.716
EC / GO 0 / 3
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

4 signals
How to read this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal TPW pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Overview

Basic information about this protein and its source genome.

Accession
PA4185
Gene
PA4185
Status
annotated
Amino acids
242
3D evidence
AlphaFold DB model

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
Hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected pocket evidence

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.716
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MKAQPDVDSNSADAPFDRKAVLGDALRRRILSMELAPGAVVDELALCDEFGLSRPPVRELLRQIAAEGYIELEANRAPRVAAMSHDSLHAFFLAAPLIYIATTQLAATHASEAEIETLKAIQEDFRKAIEEKHVENRVIHNDAFHLEIGRMAHNDYLMPSLRRLLIDHARLGKIFYRHPTTDDMQRDLELACDQHDQIVDAIQRRDPDAAADIVRAHFELSRRRMAEYAAPAGVEVALVYEG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0000987 Binding to a specific upstream regulatory DNA sequence (transcription factor recognition sequence or binding site, located in cis relative to the transcription start site (i.e., on the same strand of DNA) of a gene transcribed by some RNA polymerase. Cis-regulatory sites are often referred to as a sequence motifs, enhancers, or silencers.
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records
Show feature table
Start End DB Term Name
102 219 Pfam PF07729 FCD domain
102 219 InterPro IPR011711 GntR, C-terminal
101 227 SUPERFAMILY SSF48008 GntR ligand-binding domain-like
101 227 InterPro IPR008920 Transcription regulator FadR/GntR, C-terminal
91 228 Gene3D G3DSA:1.20.120.530 -
91 228 InterPro IPR008920 Transcription regulator FadR/GntR, C-terminal
22 80 SMART SM00345 gntr3
22 80 InterPro IPR000524 Transcription regulator HTH, GntR
19 81 Gene3D G3DSA:1.10.10.10 -
19 81 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
24 228 PANTHER PTHR43537 TRANSCRIPTIONAL REGULATOR, GNTR FAMILY
18 84 SUPERFAMILY SSF46785 Winged helix DNA-binding domain
18 84 InterPro IPR036390 Winged helix DNA-binding domain superfamily
90 220 SMART SM00895 FCD_2
90 220 InterPro IPR011711 GntR, C-terminal
23 77 Pfam PF00392 Bacterial regulatory proteins, gntR family
23 77 InterPro IPR000524 Transcription regulator HTH, GntR
16 83 ProSiteProfiles PS50949 GntR-type HTH domain profile.
16 83 InterPro IPR000524 Transcription regulator HTH, GntR

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB PA4185
AlphaFold DB full sequence Viewing
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.716
Show in viewer