Protein profile

PA4186

hypothetical protein

Genome: NC_002516.2

Gene: PA4186 Structure source: AlphaFold UniProt Q9HWJ5

Export view

Amino acids 439

Annotations 2

Features 8

PDB binders 0

Druggability 0.741

Overview

Basic information about this protein and its source genome.

Accession: PA4186
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA4186
Status: annotated
Amino acids: 439
Structure source: AlphaFold

GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.741

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MTKVTHLPADDRSCGWYHLSPPRRPKPAHYGRSAARWVVVGAGFTGLAAARQLALHFPDEEIVLVEAQEVGFGTAGRNAGFAIDLPHDIGADDYIGDIATARIGLKLNLAGQSLLREQVQRHAIDCQMKACGKYQAAVEARGVAVLDAYRRGLDRLGQAYEVIEADDLPGNIGTAFYRKALFTPGTLLVQPSALVKGLADSLPGNVSLYEHTPITAVEYGDRTLLSHPHGSILADRLVLANNAFGMSFGFLQGRMLPIFTYASLTRPLDAEEQARLGGRPYWGLIPANPYGTTVRRTPDNRLLIRNSFSFNPDGRSAGKYLERFAVRHRASFRQRFPMLPEVGFDYTWGGSLALSRNHMGHFGELAPNVYGALCCNGLGVTRGTVTGKLLADWLAGERNELIDFLLRAPGPSGNPPEPLLSLGVNLNLRWGQYRAGRES

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Sequence Features

Domain/signature hits from InterPro and related databases.

8 records

Show feature table

Start	End	DB	Term	Name
37	393	Pfam	PF01266	FAD dependent oxidoreductase
37	393	InterPro	IPR006076	FAD dependent oxidoreductase
38	394	Gene3D	G3DSA:3.50.50.60	-
38	394	InterPro	IPR036188	FAD/NAD(P)-binding domain superfamily
37	401	SUPERFAMILY	SSF51905	FAD/NAD(P)-binding domain
37	401	InterPro	IPR036188	FAD/NAD(P)-binding domain superfamily
130	355	Gene3D	G3DSA:3.30.9.10	-
30	400	PANTHER	PTHR13847	SARCOSINE DEHYDROGENASE-RELATED

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA4186	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
4				0.741
3				0.382