Promising target candidate with multiple supporting evidence streams.
6 signalsStrengths
Risks / watch
How to read this page
PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.
AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.
ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.
pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.
FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.
Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.
PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.
ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.
ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.
LigQ / LigQ_2: an internal TPW pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.
Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.
DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.
Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.
EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.
KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.
Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.
Overview
Basic information about this protein and its source genome.
- Accession
- PA4235
- Gene
- PA4235 ftnA bfrA
- Status
- annotated
- Amino acids
- 154
- 3D evidence
- Experimental + AlphaFold DB model
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected pocket evidence
The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MQGHPEVIDYLNTLLTGELAARDQYFIHSRMYEDWGFSKLYERLNHEMEEETQHADALLRRILLLEGTPRMRPDDIHPGTTVPEMLEADLKLERHVRAALAKGIALCEQHKDFVSRDILKAQLADTEEDHAYWLEQQLGLIARMGLENYLQSQI
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
8- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0008199 Binding to a ferric iron ion, Fe(III).
- GO:0004322 Catalysis of the reaction: 4 Fe2+ + 4 H+ + O2 = 4 Fe3+ + 2 H2O.
- GO:0020037 Binding to a heme, a compound composed of iron complexed in a porphyrin (tetrapyrrole) ring.
- GO:0005506 Binding to an iron (Fe) ion.
- GO:0140315 Binding to an iron ion to prevent it from interacting with other partners or to inhibit its localization to the area of the cell or complex where it is active.
- GO:0006879 A homeostatic process involved in the maintenance of a steady state level of iron ions within a cell.
- GO:0006826 The directed movement of iron (Fe) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 154 | Gene3D | G3DSA:1.20.1260.10 | - |
| 1 | 154 | InterPro | IPR012347 | Ferritin-like |
| 1 | 145 | ProSiteProfiles | PS50905 | Ferritin-like diiron domain profile. |
| 1 | 145 | InterPro | IPR009040 | Ferritin-like diiron domain |
| 41 | 61 | Coils | Coil | Coil |
| 2 | 153 | PANTHER | PTHR30295 | BACTERIOFERRITIN |
| 1 | 19 | ProSitePatterns | PS00549 | Bacterioferritin signature. |
| 1 | 19 | InterPro | IPR002024 | Bacterioferritin |
| 1 | 154 | SUPERFAMILY | SSF47240 | Ferritin-like |
| 1 | 154 | InterPro | IPR009078 | Ferritin-like superfamily |
| 2 | 154 | CDD | cd00907 | Bacterioferritin |
| 2 | 154 | InterPro | IPR002024 | Bacterioferritin |
| 85 | 105 | PRINTS | PR00601 | Bacterioferritin signature |
| 85 | 105 | InterPro | IPR002024 | Bacterioferritin |
| 128 | 149 | PRINTS | PR00601 | Bacterioferritin signature |
| 128 | 149 | InterPro | IPR002024 | Bacterioferritin |
| 23 | 43 | PRINTS | PR00601 | Bacterioferritin signature |
| 23 | 43 | InterPro | IPR002024 | Bacterioferritin |
| 3 | 22 | PRINTS | PR00601 | Bacterioferritin signature |
| 3 | 22 | InterPro | IPR002024 | Bacterioferritin |
| 106 | 126 | PRINTS | PR00601 | Bacterioferritin signature |
| 106 | 126 | InterPro | IPR002024 | Bacterioferritin |
| 44 | 64 | PRINTS | PR00601 | Bacterioferritin signature |
| 44 | 64 | InterPro | IPR002024 | Bacterioferritin |
| 1 | 154 | PIRSF | PIRSF002560 | Bacterioferritin |
| 1 | 154 | InterPro | IPR002024 | Bacterioferritin |
| 1 | 154 | NCBIfam | TIGR00754 | bacterioferritin |
| 8 | 144 | Pfam | PF00210 | Ferritin-like domain |
| 8 | 144 | InterPro | IPR008331 | Ferritin/DPS protein domain |
| 1 | 154 | FunFam | G3DSA:1.20.1260.10:FF:000005 | Bacterioferritin |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.
Loading 3D structure...
Structural evidence
7 + 1Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
PDB
3R2K
|
X-ray | 1.55 Å | A |
|
Viewing | |
|
PDB
3R2R
|
X-ray | 1.65 Å | A |
|
Loaded | |
|
PDB
3R2H
|
X-ray | 1.70 Å | A |
|
Loaded | |
|
PDB
3R2M
|
X-ray | 1.80 Å | A |
|
Loaded | |
|
PDB
3R2L
|
X-ray | 1.85 Å | A |
|
Loaded | |
|
PDB
3R2O
|
X-ray | 1.95 Å | A |
|
Loaded | |
|
PDB
3R2S
|
X-ray | 2.10 Å | A |
|
Loaded | |
|
AlphaFold DB
PA4235
|
AlphaFold DB | — | — | full sequence | — | Loaded |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.701 |
Pockets (P2RANK)
Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).
| P2RANK | Sticks | Spheres | Surfaces | Score | Probability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|---|
| 1 | 1.62 | 0.026 | ||||||
| 2 | 1.05 | 0.006 | ||||||
| 3 | 1.02 | 0.006 |
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.706 |
Ligand evidence
Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.
Structural ligand evidence is available for this target.
Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.
Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.
| Ligand | Source crystal | UniProt (homolog) | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|---|
| BTB RCSB PDB | P0ABD3 | 209.2 Da LogP -3.01 TPSA 104.4 | ✓ Ro5 | ✓ Clean |
C(CO)N(CCO)C(CO)(CO)CO
|
|
| FES RCSB PDB | Q9HY79 | 175.8 Da LogP 1.29 TPSA 0.0 | ✓ Ro5 | ✓ Clean |
S1[Fe]S[Fe]1
|
|
| KSY RCSB PDB | Q9HY79 | 296.3 Da LogP 2.32 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
c1cc(cc(c1)O)CCCNc2cccc3c2C(=O)NC3=O
|
|
| KT1 RCSB PDB | Q9HY79 | 326.4 Da LogP 2.33 TPSA 87.7 | ✓ Ro5 | ✓ Clean |
COc1cc(ccc1CCCNc2cccc3c2C(=O)NC3=O)O
|
|
| KT4 RCSB PDB | Q9HY79 | 312.3 Da LogP 2.03 TPSA 98.7 | ✓ Ro5 | ✓ Clean |
c1cc2c(c(c1)NCCCc3ccc(cc3O)O)C(=O)NC2=O
|
|
| KT7 RCSB PDB | Q9HY79 | 163.1 Da LogP 0.28 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
c1cc2c(cc1O)C(=O)NC2=O
|
|
| KTG RCSB PDB | Q9HY79 | 296.3 Da LogP 2.32 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
c1cc2c(c(c1)NCCCc3ccc(cc3)O)C(=O)NC2=O
|
|
| KTM RCSB PDB | Q9HY79 | 268.3 Da LogP 1.89 TPSA 78.4 | ✓ Ro5 | Alert |
c1ccc(c(c1)CNc2cccc3c2C(=O)NC3=O)O
|
|
| KTV RCSB PDB | Q9HY79 | 268.3 Da LogP 1.89 TPSA 78.4 | ✓ Ro5 | ✓ Clean |
c1cc(cc(c1)O)CNc2cccc3c2C(=O)NC3=O
|
|
| MLI RCSB PDB | P0ABD3 | 102.0 Da LogP -3.12 TPSA 80.3 | ✓ Ro5 | ✓ Clean |
C(C(=O)[O-])C(=O)[O-]
|
Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL bioactivity data found for this exact protein.
Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).
No ChEMBL hits found through similar proteins.
Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).
| Ligand | Tanimoto | MW · LogP · TPSA | Lipinski | PAINS | SMILES |
|---|---|---|---|---|---|
| ZINC1615342 ZINC | 1.000 | 209.2 Da LogP -3.01 TPSA 104.4 | ✓ Ro5 | ✓ Clean |
OCCN(CCO)C(CO)(CO)CO
|
| ZINC2004372 ZINC | 1.000 | 221.3 Da LogP 1.19 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCNC1CCCCC1
|
| ZINC38364153 ZINC | 0.926 | 235.3 Da LogP 1.58 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCCCNC1CCCCC1
|
| ZINC1710230 ZINC | 0.786 | 207.3 Da LogP 0.80 TPSA 66.4 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)CCNC1CCCCC1
|
| ZINC5188799 ZINC | 0.630 | 280.5 Da LogP 4.39 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
C(CCCNC1CCCCC1)CCNC1CCCCC1
|
| ZINC406661 ZINC | 0.615 | 226.0 Da LogP 1.33 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)c2cc(Br)ccc21
|
| ZINC136922 ZINC | 0.587 | 330.3 Da LogP 2.90 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
O=C(Cc1cccc2ccccc12)Nc1cccc2c1C(=O)NC2=O
|
| ZINC1695097 ZINC | 0.571 | 215.3 Da LogP 2.71 TPSA 52.5 | ✓ Ro5 | Alert |
Oc1ccccc1CNc1ccccc1O
|
| ZINC56857 ZINC | 0.571 | 320.3 Da LogP 0.68 TPSA 109.4 | ✓ Ro5 | ✓ Clean |
O=C(c1ccc2c(c1)C(=O)NC2=O)c1ccc2c(c1)C(=O)NC2=O
|
| ZINC6702053 ZINC | 0.568 | 280.3 Da LogP 1.75 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
O=C(Cc1ccccc1)Nc1cccc2c1C(=O)NC2=O
|
| ZINC146805479 ZINC | 0.560 | 212.2 Da LogP 2.31 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C1c2ccc(O)cc2-c2cc(O)ccc21
|
| ZINC235319 ZINC | 0.560 | 212.2 Da LogP 2.31 TPSA 57.5 | ✓ Ro5 | ✓ Clean |
O=C1c2cc(O)ccc2-c2ccc(O)cc21
|
| ZINC3860201 ZINC | 0.560 | 240.2 Da LogP 1.87 TPSA 74.6 | ✓ Ro5 | Alert |
O=C1c2ccc(O)cc2C(=O)c2ccc(O)cc21
|
| ZINC5844921 ZINC | 0.560 | 240.2 Da LogP 1.87 TPSA 74.6 | ✓ Ro5 | Alert |
O=C1c2ccc(O)cc2C(=O)c2cc(O)ccc21
|
| ZINC118148564 ZINC | 0.556 | 273.0 Da LogP 1.17 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)c2cc(I)ccc21
|
| ZINC3279388 ZINC | 0.537 | 204.2 Da LogP 0.53 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1cccc2c1C(=O)NC2=O
|
| ZINC2509149 ZINC | 0.531 | 211.4 Da LogP 4.27 TPSA 12.0 | ✓ Ro5 | ✓ Clean |
CCCCCCCCNC1CCCCC1
|
| ZINC130127586 ZINC | 0.529 | 260.4 Da LogP 1.38 TPSA 58.2 | ✓ Ro5 | ✓ Clean |
O=S(=O)(NCCNC1CCCCCC1)C1CC1
|
| ZINC226860030 ZINC | 0.528 | 318.3 Da LogP 1.08 TPSA 112.6 | ✓ Ro5 | Alert |
O=C1NC(=O)c2cc(S(=O)(=O)Nc3ccc(O)cc3)ccc21
|
| ZINC1512745 ZINC | 0.523 | 266.3 Da LogP 1.82 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
O=C(Nc1cccc2c1C(=O)NC2=O)c1ccccc1
|
| ZINC19900891 ZINC | 0.523 | 249.3 Da LogP 4.16 TPSA 32.3 | ✓ Ro5 | ✓ Clean |
Oc1cccc(CNc2cccc3ccccc23)c1
|
| ZINC19944707 ZINC | 0.523 | 217.2 Da LogP 3.14 TPSA 32.3 | ✓ Ro5 | ✓ Clean |
Oc1cccc(CNc2ccccc2F)c1
|
| ZINC16648552 ZINC | 0.522 | 246.3 Da LogP 1.55 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CC[C@@H](C)C(=O)Nc1cccc2c1C(=O)NC2=O
|
| ZINC16648554 ZINC | 0.522 | 246.3 Da LogP 1.55 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CC[C@H](C)C(=O)Nc1cccc2c1C(=O)NC2=O
|
| ZINC2334905 ZINC | 0.522 | 261.4 Da LogP 1.10 TPSA 63.9 | ✓ Ro5 | ✓ Clean |
CC(C)CCN(CCC(C)C)C(CO)(CO)CO
|
| ZINC3159953 ZINC | 0.522 | 261.4 Da LogP 1.38 TPSA 63.9 | ✓ Ro5 | ✓ Clean |
CCCCCN(CCCCC)C(CO)(CO)CO
|
| ZINC19367005 ZINC | 0.519 | 224.4 Da LogP 2.83 TPSA 24.1 | ✓ Ro5 | ✓ Clean |
C1CCC(NCCNC2CCCCC2)CC1
|
| ZINC208543 ZINC | 0.517 | 203.2 Da LogP 1.87 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
CC(C)(C)c1ccc2c(c1)C(=O)NC2=O
|
| ZINC5268326 ZINC | 0.511 | 298.3 Da LogP 1.89 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
O=C(Cc1ccc(F)cc1)Nc1cccc2c1C(=O)NC2=O
|
| ZINC4078608 ZINC | 0.510 | 294.3 Da LogP 2.14 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
O=C(CCc1ccccc1)Nc1cccc2c1C(=O)NC2=O
|
| ZINC1027896 ZINC | 0.500 | 266.2 Da LogP 0.61 TPSA 92.3 | ✓ Ro5 | ✓ Clean |
O=c1[nH]c(=O)c2ccc3c(=O)[nH]c(=O)c4ccc1c2c43
|
| ZINC115286332 ZINC | 0.500 | 237.3 Da LogP 2.16 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)c2c(Cc3ccccc3)cccc21
|
| ZINC13973188 ZINC | 0.500 | 330.3 Da LogP 2.90 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
O=C(Cc1ccc2ccccc2c1)Nc1cccc2c1C(=O)NC2=O
|
| ZINC1672446 ZINC | 0.500 | 228.3 Da LogP 1.49 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
N[C@@H](CCCCNC1CCCCC1)C(=O)O
|
| ZINC1728849 ZINC | 0.500 | 215.1 Da LogP 1.59 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)c2cc(C(F)(F)F)ccc21
|
| ZINC1758087 ZINC | 0.500 | 204.2 Da LogP 0.53 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CC(=O)Nc1ccc2c(c1)C(=O)NC2=O
|
| ZINC2168583 ZINC | 0.500 | 237.3 Da LogP 0.16 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)C[C@@H](O)CNC1CCCCC1
|
| ZINC2168584 ZINC | 0.500 | 237.3 Da LogP 0.16 TPSA 86.6 | ✓ Ro5 | ✓ Clean |
O=S(=O)(O)C[C@H](O)CNC1CCCCC1
|
| ZINC226859898 ZINC | 0.500 | 332.3 Da LogP 1.39 TPSA 112.6 | ✓ Ro5 | Alert |
Cc1cc(O)ccc1NS(=O)(=O)c1ccc2c(c1)C(=O)NC2=O
|
| ZINC236994621 ZINC | 0.500 | 290.4 Da LogP 0.85 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
CCS(=O)(=O)CC(=O)NCCNC1CCCCCC1
|
| ZINC37125052 ZINC | 0.500 | 256.3 Da LogP 2.03 TPSA 75.4 | ✓ Ro5 | ✓ Clean |
NC(=O)Cc1ccccc1NCc1cccc(O)c1
|
| ZINC3896782 ZINC | 0.500 | 224.2 Da LogP 2.17 TPSA 54.4 | ✓ Ro5 | Alert |
O=C1c2ccccc2C(=O)c2cc(O)ccc21
|
| ZINC401250 ZINC | 0.500 | 249.3 Da LogP 4.16 TPSA 32.3 | ✓ Ro5 | Alert |
Oc1ccccc1CNc1cccc2ccccc12
|
| ZINC44655186 ZINC | 0.500 | 213.4 Da LogP 3.12 TPSA 21.3 | ✓ Ro5 | ✓ Clean |
COCCCCNC1CCCCCCC1
|
| ZINC5297554 ZINC | 0.500 | 289.5 Da LogP 2.16 TPSA 63.9 | ✓ Ro5 | ✓ Clean |
CCCCCCN(CCCCCC)C(CO)(CO)CO
|
| ZINC55221 ZINC | 0.500 | 223.2 Da LogP 2.24 TPSA 46.2 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)c2cc(-c3ccccc3)ccc21
|
| ZINC575432149 ZINC | 0.500 | 254.0 Da LogP 0.90 TPSA 63.2 | ✓ Ro5 | ✓ Clean |
O=C1NC(=O)c2cc(Br)ccc2C1=O
|
| ZINC5840523 ZINC | 0.500 | 228.3 Da LogP 1.49 TPSA 75.3 | ✓ Ro5 | ✓ Clean |
N[C@H](CCCCNC1CCCCC1)C(=O)O
|
| ZINC97941822 ZINC | 0.500 | 317.5 Da LogP 2.94 TPSA 63.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCN(CCCCCCC)C(CO)(CO)CO
|
| ZINC97942927 ZINC | 0.500 | 373.6 Da LogP 4.51 TPSA 63.9 | ✓ Ro5 | ✓ Clean |
CCCCCCCCCN(CCCCCCCCC)C(CO)(CO)CO
|
PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.