Protein profile

PA4246

30S ribosomal protein S5

Genome: NC_002516.2

Gene: rpsE PA4246 Structure source: AlphaFold UniProt Q9HWF2
Export view
Amino acids 166
Annotations 8
Features 22
PDB binders 10
Druggability 0.68

Overview

Basic information about this protein and its source genome.

Accession
PA4246
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
rpsE PA4246
Status
annotated
Amino acids
166
Structure source
AlphaFold
GO
GO:0022627 The small subunit of a ribosome located in the cytosol. GO:0019843 Binding to a ribosomal RNA. GO:0003735 The action of a molecule that contributes to the structural integrity of the ribosome. GO:0042254 A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis. GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome. GO:0015935 The smaller of the two subunits of a ribosome.

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
26.95
Human E-value
1.17e-06
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.68
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MANNEQKRDEGYIEKLVQVNRVAKTVKGGRIFAFTALTVVGDGKGRVGFGRGKAREVPAAIQKAMEAARRNMIQVDLNGTTLQYPTKSAHGASKVYMQPASEGTGIIAGGAMRAVLEVAGVQNVLAKCYGSTNPVNVVYATFKGLKNMQAPEAVAAKRGKSVEEIL

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

8 GO

Gene Ontology (GO)

8
  • GO:0022627 The small subunit of a ribosome located in the cytosol.
  • GO:0019843 Binding to a ribosomal RNA.
  • GO:0003735 The action of a molecule that contributes to the structural integrity of the ribosome.
  • GO:0042254 A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
  • GO:0006412 The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
  • GO:0015935 The smaller of the two subunits of a ribosome.
  • GO:0005840 An intracellular organelle, about 200 A in diameter, consisting of RNA and protein. It is the site of protein biosynthesis resulting from translation of messenger RNA (mRNA). It consists of two subunits, one large and one small, each containing only protein and RNA. Both the ribosome and its subunits are characterized by their sedimentation coefficients, expressed in Svedberg units (symbol: S). Hence, the prokaryotic ribosome (70S) comprises a large (50S) subunit and a small (30S) subunit, while the eukaryotic ribosome (80S) comprises a large (60S) subunit and a small (40S) subunit. Two sites on the ribosomal large subunit are involved in translation, namely the aminoacyl site (A site) and peptidyl site (P site). Ribosomes from prokaryotes, eukaryotes, mitochondria, and chloroplasts have characteristically distinct ribosomal proteins.
  • GO:0003723 Binding to an RNA molecule or a portion thereof.

Sequence Features

Domain/signature hits from InterPro and related databases.

22 records
Show feature table
Start End DB Term Name
14 75 Pfam PF00333 Ribosomal protein S5, N-terminal domain
14 75 InterPro IPR013810 Ribosomal protein S5, N-terminal
10 77 SUPERFAMILY SSF54768 dsRNA-binding domain-like
90 158 Pfam PF03719 Ribosomal protein S5, C-terminal domain
90 158 InterPro IPR005324 Ribosomal protein S5, C-terminal
81 160 SUPERFAMILY SSF54211 Ribosomal protein S5 domain 2-like
81 160 InterPro IPR020568 Ribosomal protein S5 domain 2-type fold
29 61 ProSitePatterns PS00585 Ribosomal protein S5 signature.
29 61 InterPro IPR018192 Ribosomal protein S5, N-terminal, conserved site
11 164 NCBIfam TIGR01021 30S ribosomal protein S5
11 164 InterPro IPR005712 Ribosomal protein S5, bacterial-type
1 73 FunFam G3DSA:3.30.160.20:FF:000001 30S ribosomal protein S5
1 164 Hamap MF_01307_B 30S ribosomal protein S5 [rpsE].
1 164 InterPro IPR005712 Ribosomal protein S5, bacterial-type
76 166 FunFam G3DSA:3.30.230.10:FF:000002 30S ribosomal protein S5
5 164 PANTHER PTHR48277 MITOCHONDRIAL RIBOSOMAL PROTEIN S5
5 164 InterPro IPR000851 Ribosomal protein S5
75 166 Gene3D G3DSA:3.30.230.10 -
75 166 InterPro IPR014721 Ribosomal protein S5 domain 2-type fold, subgroup
1 74 Gene3D G3DSA:3.30.160.20 -
12 75 ProSiteProfiles PS50881 S5 double stranded RNA-binding domain profile.
12 75 InterPro IPR013810 Ribosomal protein S5, N-terminal

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA4246
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.68
5 0.222

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

60 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
C
6CAO
Q5SHQ5 323.2 Da LogP -2.45 TPSA 177.4 ✓ Ro5 ✓ Clean C1=CN(C(=O)N=C1N)[C@H]2[C@@H]([C@@H]([C@H](O2)C…
GCP
4V8Y
P25443 521.2 Da LogP -2.22 TPSA 289.9 3 viol. ✓ Clean c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@](=O…
MEQ
5J7L
P0A7W1 160.2 Da LogP -1.08 TPSA 92.4 ✓ Ro5 ✓ Clean CNC(=O)CC[C@@H](C(=O)O)N
OHX
4V8Y
P25443 286.4 Da LogP -3.55 TPSA 156.1 1 viol. ✓ Clean N[Os](N)(N)(N)(N)N
PAR
4X62
Q5SHQ5 615.6 Da LogP -8.86 TPSA 347.3 3 viol. ✓ Clean C1[C@H]([C@@H]([C@H]([C@@H]([C@H]1N)O[C@@H]2[C@…
PUT
5J7L
P0A7W1 88.2 Da LogP -0.32 TPSA 52.0 ✓ Ro5 ✓ Clean C(CCN)CN
SCM
4V56
P0A7W1 332.4 Da LogP -2.93 TPSA 129.5 ✓ Ro5 ✓ Clean C[C@@H]1CC(=O)[C@]2([C@@H](O1)O[C@@H]3[C@H]([C@…
SRY
1FJG
Q5SHQ5 581.6 Da LogP -7.74 TPSA 331.4 3 viol. ✓ Clean [H]/N=C(/N)\N[C@@H]1[C@H]([C@@H]([C@H]([C@@H]([…
TAC
5J7L
P0A7W1 444.4 Da LogP -0.21 TPSA 181.6 1 viol. ✓ Clean C[C@]1(c2cccc(c2C(=O)C3=C([C@]4([C@@H](C[C@@H]3…
WO2
1DV4
P02357 — — — [O][W]1234O[W]567(O[W]89%10(O5[P]5%11O%12[W]%13…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.